DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3625 and LOC100495442

DIOPT Version :9

Sequence 1:NP_608514.1 Gene:CG3625 / 33198 FlyBaseID:FBgn0031245 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_002942833.3 Gene:LOC100495442 / 100495442 -ID:- Length:232 Species:Xenopus tropicalis


Alignment Length:197 Identity:71/197 - (36%)
Similarity:116/197 - (58%) Gaps:5/197 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 HPWGGKFKYLTFLDAIIQALYYIVSLVNDFVGTNELTPKKPPA---VRRFKDWLMATLAFPVAIN 114
            |.:||::|||||::.::|.:::.:.:::|....  :.|||...   :.:.:|...|.||||:.:.
 Frog    35 HSYGGRWKYLTFINQVLQTVFFAICVLSDLAPL--VLPKKKKLSSFLLQLRDGTFAVLAFPIGVF 97

  Fly   115 VGVTFWTLYAIDRELVFPKVLDPVFPSWLNHVLHTNIVVFIILELFISYRSYPKRSQGLAGLAIF 179
            |..:||.:||.|||||:|||||.:.|.||||.:||.::..:::||:.....||.|..|::.:|.|
 Frog    98 VVASFWGIYAYDRELVYPKVLDSIIPQWLNHCMHTVVLPLLLVELYACSHRYPSRKWGISIMAAF 162

  Fly   180 MGAYLVWIHVVKHYSGVWVYPVLEVLQLPQRILFFAAVVGFTLSLYLLGEFLNNTVWAKEVKLAK 244
            ...|:.|:..:.|.||:||||:|..|......:|||..:..|:..|.|||.|....|....|..:
 Frog   163 SLLYMAWVLWIHHASGIWVYPLLAKLDAVGLAVFFAGAMLVTVPFYCLGELLTWFRWGTPRKPPR 227

  Fly   245 RK 246
            ::
 Frog   228 KR 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3625NP_608514.1 Far-17a_AIG1 17..233 CDD:282588 69/182 (38%)
LOC100495442XP_002942833.3 Far-17a_AIG1 35..214 CDD:368096 68/180 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 150 1.000 Domainoid score I4344
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134263
Inparanoid 1 1.050 151 1.000 Inparanoid score I4247
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 1 1.000 - - mtm9416
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5572
SonicParanoid 1 1.000 - - X992
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.