DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3625 and aig1

DIOPT Version :9

Sequence 1:NP_608514.1 Gene:CG3625 / 33198 FlyBaseID:FBgn0031245 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001093715.1 Gene:aig1 / 100101730 XenbaseID:XB-GENE-954971 Length:238 Species:Xenopus tropicalis


Alignment Length:224 Identity:80/224 - (35%)
Similarity:128/224 - (57%) Gaps:14/224 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LTAVVQFGY-GIYYDYNYVQFPTSEPEMRIHHPWGGKFKYLTFLDAIIQALYYIVSLVNDFV--- 83
            |.|.:...| .:...|..::.|.       |..:||.:|:|||:|.:|||:::.:.:::|..   
 Frog     9 LRAAILLSYLSVLCHYKAIEMPA-------HQTYGGSWKFLTFIDLVIQAVFFGICVLSDLSSLL 66

  Fly    84 ---GTNELTPKKPPAVRRFKDWLMATLAFPVAINVGVTFWTLYAIDRELVFPKVLDPVFPSWLNH 145
               ..|:...::...:...:||:||.|||||.:.|...||.||..|||||:||:||...|.||||
 Frog    67 TKGSDNQEQERQLKKLISLRDWVMAVLAFPVGVFVVTMFWILYIYDRELVYPKLLDNFIPPWLNH 131

  Fly   146 VLHTNIVVFIILELFISYRSYPKRSQGLAGLAIFMGAYLVWIHVVKHYSGVWVYPVLEVLQLPQR 210
            .:||.::.||::|:..::..||.|:.|:..:.:|...|::|:..|.|.:|:||||:||.:....:
 Frog   132 GMHTTVLPFILIEMRTTHHQYPSRTCGIVTVCLFSICYILWVCWVHHMTGMWVYPLLEYISPGAK 196

  Fly   211 ILFFAAVVGFTLSLYLLGEFLNNTVWAKE 239
            |:||..|.......|:|||.|||.:|..|
 Frog   197 IVFFIIVTVVINMFYILGEKLNNFIWEAE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3625NP_608514.1 Far-17a_AIG1 17..233 CDD:282588 76/216 (35%)
aig1NP_001093715.1 Far-17a_AIG1 12..219 CDD:368096 74/213 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49430
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10989
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.