DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11601 and YHR140W

DIOPT Version :9

Sequence 1:NP_001285545.1 Gene:CG11601 / 33197 FlyBaseID:FBgn0031244 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_012009.1 Gene:YHR140W / 856543 SGDID:S000001182 Length:239 Species:Saccharomyces cerevisiae


Alignment Length:198 Identity:39/198 - (19%)
Similarity:75/198 - (37%) Gaps:39/198 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LKARWG----------------GKFKYLTFLDVILQAIYHSLALLNDLFGDNNVSGDSKSMLRSV 123
            |.:.||                |..::||.:.:|...|.:::.:.|.....||     |..|.:.
Yeast    20 LTSTWGFVRATSVVLPPSLSKAGHKQFLTIISIIATIINNAVNISNYYIQRNN-----KMNLETK 79

  Fly   124 R--DYVFAAFAFPVA----HNVCLSFWVIYVWDRELIF---PSALDAIFPSWLNHVVHTNVALLA 179
            :  |::......||:    ..|...:|.:.::...||.   .|.....||..::..:|....|..
Yeast    80 KKSDFISRHVTLPVSLVLESIVATVYWPLRLFFVNLIMHGVESTAKTPFPMTVDMAIHLYPILYL 144

  Fly   180 IMDLF-----TCFRRYPSRLAGITGNVSF-ILLYIIWLHIVRYFSGE-WVYPILEVLPAYLRYVF 237
            :.|.:     |.|:........|..:::| ...|:.:|  :....|: :.||.|:|...|...:|
Yeast   145 LADHYLSGSGTKFKLSNKHAWLIVTSLAFSYFQYLAFL--IDAGQGQAYPYPFLDVNEPYKSIIF 207

  Fly   238 LAL 240
            :.:
Yeast   208 VVV 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11601NP_001285545.1 Far-17a_AIG1 40..257 CDD:282588 39/198 (20%)
YHR140WNP_012009.1 Far-17a_AIG1 <83..220 CDD:368096 26/130 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3989
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102603
Panther 1 1.100 - - O PTHR10989
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.