DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11601 and Aig1

DIOPT Version :9

Sequence 1:NP_001285545.1 Gene:CG11601 / 33197 FlyBaseID:FBgn0031244 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_079722.1 Gene:Aig1 / 66253 MGIID:1913503 Length:262 Species:Mus musculus


Alignment Length:227 Identity:79/227 - (34%)
Similarity:122/227 - (53%) Gaps:25/227 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LLAAAQFSY-GIYFHYFRVHWPTDLLDEDELKARWGGKFKYLTFLDVILQAIYHSLALLNDLF-- 107
            |..|...|| .|..:|..:..|:        ...:||.:|:|||:|:::||::..:.:|.||.  
Mouse     9 LRVAILLSYCSILCNYKAIEMPS--------HQTYGGSWKFLTFIDLVIQAVFFGICVLTDLSSL 65

  Fly   108 ---GDNNVSGDSKSMLR---SVRDYVFAAFAFPVAHNVCLSFWVIYVWDRELIFPSALDAIFPSW 166
               |..|  .:.:..||   |:||:..|..||||...|...||.||.:|||:|:|..||...|.|
Mouse    66 LTRGSGN--QEQERQLRKLISLRDWTLAVLAFPVGVFVVAVFWTIYAYDREMIYPRLLDNFIPGW 128

  Fly   167 LNHVVHTNVALLAIMDLFTCFRRYPSRLAGITGNVSFILLYIIWLHIVRYFSGEWVYPILEVLPA 231
            |||.:||.|....::::.|...:||||.:|:....:|.:.||:|:..:.:.:|.||||.||.:.:
Mouse   129 LNHGMHTTVLPFILIEMRTSHHQYPSRSSGLAAICTFSVGYILWVCWIHHVTGMWVYPFLEHIGS 193

  Fly   232 YLRYVFL---ALLVGFNLVCYLLGEFANNVVW 260
            ..|.:|.   .:|:.|   .|||||..|:.:|
Mouse   194 GARIIFFGSTTILMNF---LYLLGEVLNSYIW 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11601NP_001285545.1 Far-17a_AIG1 40..257 CDD:282588 77/222 (35%)
Aig1NP_079722.1 Far-17a_AIG1 12..219 CDD:368096 76/219 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847207
Domainoid 1 1.000 166 1.000 Domainoid score I3859
eggNOG 1 0.900 - - E1_KOG3989
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I4084
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49430
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 1 1.000 - - otm42705
orthoMCL 1 0.900 - - OOG6_102603
Panther 1 1.100 - - O PTHR10989
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X992
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.