DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11601 and AIG1

DIOPT Version :9

Sequence 1:NP_001285545.1 Gene:CG11601 / 33197 FlyBaseID:FBgn0031244 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001353273.1 Gene:AIG1 / 51390 HGNCID:21607 Length:285 Species:Homo sapiens


Alignment Length:285 Identity:84/285 - (29%)
Similarity:130/285 - (45%) Gaps:69/285 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LLAAAQFSY-GIYFHYFRVHWPTDLLDEDELKARWGGKFKYLTFLDV------------------ 91
            |..|...|| .|..:|..:..|:        ...:||.:|:|||:|:                  
Human     9 LRMAILLSYCSILCNYKAIEMPS--------HQTYGGSWKFLTFIDLMESHSVTRLECSGTISAH 65

  Fly    92 -----------------------------ILQAIYHSLALLNDLF-----GDNNVSGDSK-SMLR 121
                                         ::||::..:.:|.||.     |..|...:.: ..|.
Human    66 CNLCLLCSSYSPASASRVAGTTGVCHHARVIQAVFFGICVLTDLSSLLTRGSGNQEQERQLKKLI 130

  Fly   122 SVRDYVFAAFAFPVAHNVCLSFWVIYVWDRELIFPSALDAIFPSWLNHVVHTNVALLAIMDLFTC 186
            |:||::.|..||||...|...||:||.:|||:|:|..||...|.||||.:||.|....::::.|.
Human   131 SLRDWMLAVLAFPVGVFVVAVFWIIYAYDREMIYPKLLDNFIPGWLNHGMHTTVLPFILIEMRTS 195

  Fly   187 FRRYPSRLAGITGNVSFILLYIIWLHIVRYFSGEWVYPILEVLPAYLRYVFL---ALLVGFNLVC 248
            ..:||||.:|:|...:|.:.||:|:..|.:.:|.||||.||.:....|.:|.   .:|:.|   .
Human   196 HHQYPSRSSGLTAICTFSVGYILWVCWVHHVTGMWVYPFLEHIGPGARIIFFGSTTILMNF---L 257

  Fly   249 YLLGEFANNVVWGPEFKLLNQQKLK 273
            |||||..||.:|..: |.:.::|.|
Human   258 YLLGEVLNNYIWDTQ-KSMEEEKEK 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11601NP_001285545.1 Far-17a_AIG1 40..257 CDD:282588 78/267 (29%)
AIG1NP_001353273.1 Far-17a_AIG1 12..266 CDD:309749 77/264 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156795
Domainoid 1 1.000 167 1.000 Domainoid score I3862
eggNOG 1 0.900 - - E1_KOG3989
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 173 1.000 Inparanoid score I4081
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49430
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 1 1.000 - - otm40630
orthoMCL 1 0.900 - - OOG6_102603
Panther 1 1.100 - - O PTHR10989
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X992
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.