DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11601 and C37E2.10

DIOPT Version :9

Sequence 1:NP_001285545.1 Gene:CG11601 / 33197 FlyBaseID:FBgn0031244 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001355467.1 Gene:C37E2.10 / 39010802 WormBaseID:WBGene00304175 Length:223 Species:Caenorhabditis elegans


Alignment Length:199 Identity:51/199 - (25%)
Similarity:81/199 - (40%) Gaps:39/199 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KFKYLTFLDVILQAIYHSLALLNDLFGDNNVSGDSKSML-------------------------- 120
            |.:||..:..||.||    ||.|  :||   |.|||.:.                          
 Worm     4 KSQYLFIVIAILWAI----ALYN--YGD---SPDSKELYIFRIVKLTNIFGALYSVSVVDGYQGG 59

  Fly   121 --RSVRDYVFAAFAFPVAHNVCLSFWVIYVWDRELIFPSALDAIFPSWLNHVVHTNVALLAIMDL 183
              |...|::.....||||....:.||.::|:||.|:.|.|...:|...|.|...|...|.|::|.
 Worm    60 KSRKFVDFLHFTVMFPVAAISFVLFWALFVFDRTLVIPQAKLHVFRWLLCHFHDTYPLLYALLDS 124

  Fly   184 FTCFRRYPSRLAGITGNVSFILLYIIWLHIVRYFSGEWVYPILEVL--PAYLRYVFLALLVGFNL 246
            :...|:.|..|||:..:.:.:.:|.:....|::.....:|||.:.|  |.:....|....:.|..
 Worm   125 YFHKRKVPDHLAGLVISATLVFIYFMTARCVKFVDSGRIYPIFQTLSVPQFALIAFATYFLTFKA 189

  Fly   247 VCYL 250
            ..::
 Worm   190 AVFI 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11601NP_001285545.1 Far-17a_AIG1 40..257 CDD:282588 51/199 (26%)
C37E2.10NP_001355467.1 Far-17a_AIG1 <40..194 CDD:309749 35/154 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I5037
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I3702
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 1 1.000 - - mtm4768
orthoMCL 1 0.900 - - OOG6_102603
Panther 1 1.100 - - O PTHR10989
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X992
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.960

Return to query results.
Submit another query.