DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11601 and Adtrp

DIOPT Version :9

Sequence 1:NP_001285545.1 Gene:CG11601 / 33197 FlyBaseID:FBgn0031244 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001014166.1 Gene:Adtrp / 361228 RGDID:1305679 Length:230 Species:Rattus norvegicus


Alignment Length:222 Identity:70/222 - (31%)
Similarity:117/222 - (52%) Gaps:20/222 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 FHYFRVHW--------PTDLLDEDELKA-RWGGKFKYLTFLDVILQAIYHSLALLNDLFGDNNVS 113
            :|:..::|        |....||::||. ..||:.||||.|:::|||::..:|.|:|:.  ..|.
  Rat     9 YHFVVLNWYIFLNYYIPQIGKDEEKLKEFHDGGRSKYLTLLNLLLQAVFFGVACLDDVL--KRVI 71

  Fly   114 G--DSKSMLRSVRDYVFAAFAFPVAHNVCLSFWVIYVWDRELIFPSALDAIFPSWLNHVVHTNVA 176
            |  |.| .:...||.:|...|||::..|.|.||.::.:||.|::|..||..||:|:||.:||::.
  Rat    72 GRKDIK-FITYFRDLLFTTLAFPLSTFVFLVFWSLFHYDRSLVYPKGLDDFFPAWVNHAMHTSIF 135

  Fly   177 LLAIMDLFTCFRRYPSRLAGIT--GNVSF-ILLYIIWLHIVRYFSGEWVYPILEVLPAYLRYVFL 238
            ..::.:.......|||:..|::  |..:| .::.|:|.::.   :|.||||:...|......:|.
  Rat   136 PFSLAETVLRPHNYPSKKLGLSLLGACNFAYIIRILWRYVQ---TGNWVYPVFASLSPLGIILFF 197

  Fly   239 ALLVGFNLVCYLLGEFANNVVWGPEFK 265
            :.....:...||.||..|:..||...|
  Rat   198 SASYILSASLYLFGEKINHWKWGATVK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11601NP_001285545.1 Far-17a_AIG1 40..257 CDD:282588 66/212 (31%)
AdtrpNP_001014166.1 Far-17a_AIG1 5..216 CDD:368096 66/212 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350716
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3989
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49430
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102603
Panther 1 1.100 - - O PTHR10989
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X992
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.720

Return to query results.
Submit another query.