DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11601 and CG3625

DIOPT Version :9

Sequence 1:NP_001285545.1 Gene:CG11601 / 33197 FlyBaseID:FBgn0031244 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_608514.1 Gene:CG3625 / 33198 FlyBaseID:FBgn0031245 Length:248 Species:Drosophila melanogaster


Alignment Length:244 Identity:118/244 - (48%)
Similarity:161/244 - (65%) Gaps:6/244 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NDAYTSGAFKYLRFLVHLLAAAQFSYGIYFHYFRVHWPTDLLDEDELKAR--WGGKFKYLTFLDV 91
            |..| .|.:..||.|:||.|..||.||||:.|..|.:||   .|.|::..  ||||||||||||.
  Fly     7 NSVY-QGVYGALRTLLHLTAVVQFGYGIYYDYNYVQFPT---SEPEMRIHHPWGGKFKYLTFLDA 67

  Fly    92 ILQAIYHSLALLNDLFGDNNVSGDSKSMLRSVRDYVFAAFAFPVAHNVCLSFWVIYVWDRELIFP 156
            |:||:|:.::|:||..|.|.::......:|..:|::.|..|||||.||.::||.:|..||||:||
  Fly    68 IIQALYYIVSLVNDFVGTNELTPKKPPAVRRFKDWLMATLAFPVAINVGVTFWTLYAIDRELVFP 132

  Fly   157 SALDAIFPSWLNHVVHTNVALLAIMDLFTCFRRYPSRLAGITGNVSFILLYIIWLHIVRYFSGEW 221
            ..||.:||||||||:|||:.:..|::||..:|.||.|..|:.|...|:..|::|:|:|:::||.|
  Fly   133 KVLDPVFPSWLNHVLHTNIVVFIILELFISYRSYPKRSQGLAGLAIFMGAYLVWIHVVKHYSGVW 197

  Fly   222 VYPILEVLPAYLRYVFLALLVGFNLVCYLLGEFANNVVWGPEFKLLNQQ 270
            |||:||||....|.:|.|.:|||.|..||||||.||.||..|.||..::
  Fly   198 VYPVLEVLQLPQRILFFAAVVGFTLSLYLLGEFLNNTVWAKEVKLAKRK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11601NP_001285545.1 Far-17a_AIG1 40..257 CDD:282588 108/218 (50%)
CG3625NP_608514.1 Far-17a_AIG1 17..233 CDD:282588 108/218 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469168
Domainoid 1 1.000 159 1.000 Domainoid score I4045
eggNOG 1 0.900 - - E1_KOG3989
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 164 1.000 Inparanoid score I4176
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 1 1.000 - - mtm6435
orthoMCL 1 0.900 - - OOG6_102603
Panther 1 1.100 - - P PTHR10989
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X992
1110.800

Return to query results.
Submit another query.