DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11601 and C37E2.2

DIOPT Version :9

Sequence 1:NP_001285545.1 Gene:CG11601 / 33197 FlyBaseID:FBgn0031244 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001024448.1 Gene:C37E2.2 / 183292 WormBaseID:WBGene00007994 Length:225 Species:Caenorhabditis elegans


Alignment Length:204 Identity:55/204 - (26%)
Similarity:93/204 - (45%) Gaps:23/204 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IYFHYFRVHWPTDLLDEDELKARWGG-----KFKYLTFLDVILQAIYHSLALLNDLFGDNNVSGD 115
            :.|....:.|.:.|..:...:.|.|.     |...||.|:.:|...|..:.||          |.
 Worm     7 LLFTMMSIIWLSALWFDINRQPRLGHHWYVYKLVMLTNLNFVLCVFYSVMILL----------GY 61

  Fly   116 SKSMLRSVRDYVFAAFAFPVAHNVCLSFWVIYVWDRELIFPSALDAIFPSWLNHVVHTNVALLAI 180
            ....|:.:.|::.....|||....|..||.:|..:..|:.|..:..:.||||||:.||...:..|
 Worm    62 KSEKLQKISDFMHFTSIFPVGMITCGLFWGLYAINPALVMPDWIAKLIPSWLNHITHTYPIIFII 126

  Fly   181 MDLFTCFRRYPSRLAGITGNVSFILLYIIWLHIVRYFSGEWVYPILEVLPAYLRYVFLALLVGFN 245
            :|.:...|..|..:|.:..:.:.:.:|.:.:..||:|.|.|:||||.:. |:..:| ::.::|| 
 Worm   127 LDSYFHKRTPPKTIASLIFSAALVFVYFMIICYVRFFDGYWLYPILSLF-AFEHFV-ISYIIGF- 188

  Fly   246 LVCYLLGEF 254
                 ||.|
 Worm   189 -----LGFF 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11601NP_001285545.1 Far-17a_AIG1 40..257 CDD:282588 55/204 (27%)
C37E2.2NP_001024448.1 Far-17a_AIG1 5..203 CDD:282588 55/204 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I5037
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I3702
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49430
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 1 1.000 - - mtm4768
orthoMCL 1 0.900 - - OOG6_102603
Panther 1 1.100 - - O PTHR10989
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X992
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.