DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11601 and Adtrp

DIOPT Version :9

Sequence 1:NP_001285545.1 Gene:CG11601 / 33197 FlyBaseID:FBgn0031244 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_780626.1 Gene:Adtrp / 109254 MGIID:1924596 Length:262 Species:Mus musculus


Alignment Length:266 Identity:83/266 - (31%)
Similarity:133/266 - (50%) Gaps:48/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AKEAVEATKAQLNTCNDAYTSGAFKYLRFLVHLLAAAQFSYGIYFHYFRVHWPTDLLDEDELKA- 77
            ::||:..|    .||              :.|.|.   .::.|:.:|   |.|....:|::|:. 
Mouse    29 SREAMTKT----TTC--------------VYHFLV---LNWYIFLNY---HIPQIGRNEEKLREF 69

  Fly    78 RWGGKFKYLTFLDVILQAIYHSLALLNDLFGDNNVSG--DSKSMLRSVRDYVFAAFAFPVAHNVC 140
            ..||:.||||.|:::||||:..:|.|:|:.  ..|.|  |.| .:.|.||.:|...|||::..|.
Mouse    70 HDGGRSKYLTLLNLLLQAIFFGVACLDDVL--KRVIGRKDIK-FVTSFRDLLFTTMAFPISTFVF 131

  Fly   141 LSFWVIYVWDRELIFPSALDAIFPSWLNHVVHTNVALLAIMDLFTCFRRYPSRLAGITGNVSFIL 205
            |.||.::.:||.|::|..||..||:|:||.:||::...::.:.......|||:..|:|...:|..
Mouse   132 LVFWTLFHYDRSLVYPKGLDDFFPAWVNHAMHTSIFPFSLFETILRPHNYPSKKLGLTLLGAFNF 196

  Fly   206 LYII---WLHIVRYFSGEWVYPILEVLPAYLRYVFLA----LLVGFNLVCYLLGEFANNVVWG-- 261
            .|||   |.::.   :|.||||:.:.|......:|.:    |:.|.    ||.||..|:..||  
Mouse   197 AYIIRILWRYVQ---TGNWVYPVFDSLSPLGIIIFFSAAYILVAGI----YLFGEKINHWKWGAI 254

  Fly   262 --PEFK 265
              |:.|
Mouse   255 AKPQMK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11601NP_001285545.1 Far-17a_AIG1 40..257 CDD:282588 73/226 (32%)
AdtrpNP_780626.1 Far-17a_AIG1 37..248 CDD:282588 75/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847204
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3989
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49430
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102603
Panther 1 1.100 - - O PTHR10989
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X992
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.720

Return to query results.
Submit another query.