DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11601 and LOC100537455

DIOPT Version :9

Sequence 1:NP_001285545.1 Gene:CG11601 / 33197 FlyBaseID:FBgn0031244 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_021336569.1 Gene:LOC100537455 / 100537455 -ID:- Length:242 Species:Danio rerio


Alignment Length:238 Identity:78/238 - (32%)
Similarity:119/238 - (50%) Gaps:43/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 AFKYLRFLVHLLAAAQFS---YGIYFHYFRVHWPTDLLDEDELKARWGGKFKYLTFLDVILQAIY 97
            ||.:..|::..:.|...|   .||:.                    :||.:||||||:::||.::
Zfish    26 AFSWYAFIIQCIYAKDVSDLPSGIFV--------------------YGGPWKYLTFLNLVLQMVF 70

  Fly    98 HSLALLNDL--FGDNNVSGDSKSMLRSVRDYVFAAFAFPVAHNVCLSFWVIYVWDRELIFPSALD 160
            ..||.:|||  .|    .|...|:|...:|.:|:.|.|||...|.|.||:|:.:||:|::|:::|
Zfish    71 FGLASVNDLQPVG----KGSKMSLLCLCKDLLFSVFVFPVGMFVVLLFWLIFAYDRQLVYPASID 131

  Fly   161 AIFPSWLNHVVHTNVALLAIMDLFT---CFRRYPSRLA--GITGNVSFILLYIIWLHIVRYFSGE 220
            ..||.||||.:||.|..:...::..   .|.:..:.||  |:.|     |.|:.|:..|....|.
Zfish   132 NFFPPWLNHAMHTVVLPILFGEILLEPHVFPKTKNGLAALGVVG-----LAYLGWVIWVYCTVGI 191

  Fly   221 WVYPILEVL--PAYLRYVFLALLVGFNLVCYLLGEFANNVVWG 261
            ||||:|.:.  .....:.||.:||...|  :|||:..|..|||
Zfish   192 WVYPLLGLFSHSGLAIFFFLNMLVVSLL--FLLGKALNYKVWG 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11601NP_001285545.1 Far-17a_AIG1 40..257 CDD:282588 72/228 (32%)
LOC100537455XP_021336569.1 Far-17a_AIG1 23..227 CDD:309749 74/231 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49430
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102603
Panther 1 1.100 - - O PTHR10989
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X992
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.