DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11601 and LOC100495442

DIOPT Version :9

Sequence 1:NP_001285545.1 Gene:CG11601 / 33197 FlyBaseID:FBgn0031244 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_002942833.3 Gene:LOC100495442 / 100495442 -ID:- Length:232 Species:Xenopus tropicalis


Alignment Length:200 Identity:80/200 - (40%)
Similarity:115/200 - (57%) Gaps:9/200 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 WGGKFKYLTFLDVILQAIYHSLALLNDLF-----GDNNVSGDSKSMLRSVRDYVFAAFAFPVAHN 138
            :||::|||||::.:||.::.::.:|:||.     ....:|    |.|..:||..||..|||:...
 Frog    37 YGGRWKYLTFINQVLQTVFFAICVLSDLAPLVLPKKKKLS----SFLLQLRDGTFAVLAFPIGVF 97

  Fly   139 VCLSFWVIYVWDRELIFPSALDAIFPSWLNHVVHTNVALLAIMDLFTCFRRYPSRLAGITGNVSF 203
            |..|||.||.:||||::|..||:|.|.||||.:||.|..|.:::|:.|..|||||..||:...:|
 Frog    98 VVASFWGIYAYDRELVYPKVLDSIIPQWLNHCMHTVVLPLLLVELYACSHRYPSRKWGISIMAAF 162

  Fly   204 ILLYIIWLHIVRYFSGEWVYPILEVLPAYLRYVFLALLVGFNLVCYLLGEFANNVVWGPEFKLLN 268
            .|||:.|:..:.:.||.||||:|..|.|....||.|..:...:..|.|||......||...|...
 Frog   163 SLLYMAWVLWIHHASGIWVYPLLAKLDAVGLAVFFAGAMLVTVPFYCLGELLTWFRWGTPRKPPR 227

  Fly   269 QQKLK 273
            ::|.|
 Frog   228 KRKAK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11601NP_001285545.1 Far-17a_AIG1 40..257 CDD:282588 75/182 (41%)
LOC100495442XP_002942833.3 Far-17a_AIG1 35..214 CDD:368096 75/180 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 150 1.000 Domainoid score I4344
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4247
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 1 1.000 - - mtm9416
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X992
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.