DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11601 and aig1

DIOPT Version :9

Sequence 1:NP_001285545.1 Gene:CG11601 / 33197 FlyBaseID:FBgn0031244 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001093715.1 Gene:aig1 / 100101730 XenbaseID:XB-GENE-954971 Length:238 Species:Xenopus tropicalis


Alignment Length:225 Identity:80/225 - (35%)
Similarity:121/225 - (53%) Gaps:15/225 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LLAAAQFSY-GIYFHYFRVHWPTDLLDEDELKARWGGKFKYLTFLDVILQAIYHSLALLNDLF-- 107
            |.||...|| .:..||..:..|.        ...:||.:|:|||:|:::||::..:.:|:||.  
 Frog     9 LRAAILLSYLSVLCHYKAIEMPA--------HQTYGGSWKFLTFIDLVIQAVFFGICVLSDLSSL 65

  Fly   108 ----GDNNVSGDSKSMLRSVRDYVFAAFAFPVAHNVCLSFWVIYVWDRELIFPSALDAIFPSWLN 168
                .||.........|.|:||:|.|..||||...|...||::|::||||::|..||...|.|||
 Frog    66 LTKGSDNQEQERQLKKLISLRDWVMAVLAFPVGVFVVTMFWILYIYDRELVYPKLLDNFIPPWLN 130

  Fly   169 HVVHTNVALLAIMDLFTCFRRYPSRLAGITGNVSFILLYIIWLHIVRYFSGEWVYPILEVLPAYL 233
            |.:||.|....::::.|...:||||..||.....|.:.||:|:..|.:.:|.||||:||.:....
 Frog   131 HGMHTTVLPFILIEMRTTHHQYPSRTCGIVTVCLFSICYILWVCWVHHMTGMWVYPLLEYISPGA 195

  Fly   234 RYVFLALLVGFNLVCYLLGEFANNVVWGPE 263
            :.||..::.....:.|:|||..||.:|..|
 Frog   196 KIVFFIIVTVVINMFYILGEKLNNFIWEAE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11601NP_001285545.1 Far-17a_AIG1 40..257 CDD:282588 76/217 (35%)
aig1NP_001093715.1 Far-17a_AIG1 12..219 CDD:368096 74/214 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49430
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10989
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.