DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smo and Fzd10

DIOPT Version :9

Sequence 1:NP_523443.1 Gene:smo / 33196 FlyBaseID:FBgn0003444 Length:1036 Species:Drosophila melanogaster
Sequence 2:NP_780493.1 Gene:Fzd10 / 93897 MGIID:2136761 Length:582 Species:Mus musculus


Alignment Length:515 Identity:137/515 - (26%)
Similarity:231/515 - (44%) Gaps:79/515 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 DLTDFHTEKELNDKLNDYYALKHVPKCWAAIQPFLCAVFKPKC-EKINGEDMVYLPSYEMCRITM 176
            :|.....::|...:|:::..|... .|.:.::.|||:::.|.| |:::    ..:|:   ||:..
Mouse    55 NLMGHENQREAAIQLHEFAPLVEY-GCHSHLRFFLCSLYAPMCTEQVS----TPIPA---CRVMC 111

  Fly   177 EPCR-----ILYNTTF-FPKFLRCNETLFPTK---------CTNGARGMKFNGTGQCLSPLVPTD 226
            |..|     |:....| :|..|.|::  .|.|         ..|........|:|. ..||....
Mouse   112 EQARLKCSPIMEQFKFRWPDSLDCSK--LPNKNDPNYLCMEAPNNGSDEPSRGSGM-FPPLFRPQ 173

  Fly   227 T--SASYY------PGIEGC-----------GVRCKDPLYT---------DDEHRQIHKLIGWAG 263
            .  ||..:      ||..||           ...|. ||.|         ||:...:..|..|: 
Mouse   174 RPHSAQEHPLKDGGPGRAGCDNPGKFHHVEKSESCA-PLCTPGVDVYWSRDDKRFAVVWLAIWS- 236

  Fly   264 SICLLSNLFVVSTFFIDWKNANKYPAVIVFYINLCFLIACVGWLLQFTSGSREDIVCRKDGTLRH 328
            .:|..|:.|.|.||.|| .:..:||...:.::::|:.:..||::::..:|: |.|.|.:|....:
Mouse   237 VLCFFSSAFTVLTFLID-PSRFRYPERPIIFLSMCYCVYSVGYIIRLFAGA-ESIACDRDSGQLY 299

  Fly   329 SEPTAGENLSCIVIFVLVYYFLTAGMVWFVFLTYAWHWRA---MGHVQDRIDKKGSYFHLVAWSL 390
            ......|:..|.::|:::|||..|..:|:|.||..|...|   .||  :.|:...|||||.||::
Mouse   300 VIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGH--EAIEANSSYFHLAAWAI 362

  Fly   391 PLVLTITTMAFSEVDGNSIVGICFVGYINHSMRAGLLLGPLCGVILIGGYFITRGMVMLFGLKHF 455
            |.|.||..:....|.|:.:.|:|:||.::.:...|.:|.||...::||..||..|.|.||.::. 
Mouse   363 PAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLVPLACYLVIGTSFILSGFVALFHIRR- 426

  Fly   456 ANDIKSTSASN--KIHLIIMRMGVCALLTLVFILVAIACHVTEFRHADEWAQSFRQFIICKISSV 518
               :..|...|  |:..:::|:||.:||..|.....|||:..|..:.|.|.....|. .||:::.
Mouse   427 ---VMKTGGENTDKLEKLMVRIGVFSLLYTVPATCVIACYFYERLNMDYWKMLATQH-KCKMNNQ 487

  Fly   519 FEEKSSCRIENRPSVGVLQLHLLCLFSSGIVMSTWCWTPSSIETW--------KRYIRKK 570
            .:........:.|:|.|..:.:..|...||....|.||..::::|        ||..|:|
Mouse   488 TKTPDCLMTTSIPAVEVFMVKVSMLLVVGITSGVWVWTSKTLQSWQHVCSRGLKRKSRRK 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smoNP_523443.1 CRD_SMO 86..221 CDD:143560 26/123 (21%)
Frizzled 246..568 CDD:279827 99/343 (29%)
Fzd10NP_780493.1 CRD_FZ 31..157 CDD:295308 24/111 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..189 7/36 (19%)
Frizzled 219..536 CDD:279827 95/326 (29%)
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 527..532 0/4 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 561..582
PDZ-binding 580..582
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D509772at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.