DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smo and FZD4

DIOPT Version :9

Sequence 1:NP_523443.1 Gene:smo / 33196 FlyBaseID:FBgn0003444 Length:1036 Species:Drosophila melanogaster
Sequence 2:NP_036325.2 Gene:FZD4 / 8322 HGNCID:4042 Length:537 Species:Homo sapiens


Alignment Length:547 Identity:152/547 - (27%)
Similarity:247/547 - (45%) Gaps:104/547 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 RCYP--TSNATNTCFG-SKLP----YEL---SSLDLTDFHTEKELNDKLNDYYALKHVPKCWAAI 143
            ||.|  .|...|..:. :|:|    :||   :.|.||.|       ..|..|       .|.:.:
Human    44 RCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTF-------TPLIQY-------GCSSQL 94

  Fly   144 QPFLCAVFKPKC-EKINGEDMVYLPSYEMCRITMEPCR-ILYNTTF-FPKFLRCNETLFPTKCTN 205
            |.|||:|:.|.| ||||   :...|...||......|. :|....| :|:.|.|::  ||.:  |
Human    95 QFFLCSVYVPMCTEKIN---IPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSK--FPPQ--N 152

  Fly   206 GARGMKFNGTGQ------CLSPLVPTD------TSASYYPGIE---GCGVRC--KDPLYTDD--E 251
            ....|...|.|.      ..:|:.|.:      |::..|..::   .|.::|  ...||:..  |
Human   153 DHNHMCMEGPGDEEV
PLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKE 217

  Fly   252 HRQIHKLIGWAGSICLLSNLFVVSTFFIDWKNANKYPAVIVFYINLCFLIACVGWLLQFTSGSRE 316
            ...|...: || |:|.:|..|.|.||.|| .:...||...:.::::|:.|..:.::::.|.| ||
Human   218 FTDIWMAV-WA-SLCFISTAFTVLTFLID-SSRFSYPERPIIFLSMCYNIYSIAYIVRLTVG-RE 278

  Fly   317 DIVCRKDGTLRHSEPT----AGENLSCIVIFVLVYYFLTAGMVWFVFLTYAWHWRA---MGHVQD 374
            .|.|..:   ..:||.    ..:|..|.:||:|:|:|..|..:|:|.||..|...|   .||  :
Human   279 RISCDFE---EAAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGH--E 338

  Fly   375 RIDKKGSYFHLVAWSLPLVLTITTMAFSEVDGNSIVGICFVGYINHSMRAGLLLGPLCGVILIGG 439
            .|:...||||:.||::|.|.||..:....||.:.:.|:|:||..|.....|.::.||...::||.
Human   339 AIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGT 403

  Fly   440 YFITRGMVMLFGLKHFANDIKSTSASNKIHLIIMRMGVCALLTLVFILVAIACHVTEFRHADEWA 504
            .||..|:|.||.::  :|..|..:.::|:..:::::||.::|..|.....|||:   |.....||
Human   404 LFIAAGLVALFKIR--SNLQKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACY---FYEISNWA 463

  Fly   505 QSFRQFIICKISSVFEEKSSCRIENRPSVGVLQLHLLCLFSS---GIVMSTWCWTPSSIETWKRY 566
                   :.:.|:   :.|:..:|           :|.:|.|   ||....|.|:..::.||   
Human   464 -------LFRYSA---DDSNMAVE-----------MLKIFMSLLVGITSGMWIWSAKTLHTW--- 504

  Fly   567 IRKKCGKEVVEEVKMPKHKVIAQTWAK 593
              :||...:|...|:.:.| ....|.|
Human   505 --QKCSNRLVNSGKVKREK-RGNGWVK 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smoNP_523443.1 CRD_SMO 86..221 CDD:143560 42/150 (28%)
Frizzled 246..568 CDD:279827 97/333 (29%)
FZD4NP_036325.2 CRD_FZ4 42..167 CDD:143557 42/143 (29%)
7tmF_FZD4 209..509 CDD:320166 99/339 (29%)
TM helix 1 218..243 CDD:320166 10/26 (38%)
TM helix 2 252..273 CDD:320166 2/20 (10%)
TM helix 3 303..329 CDD:320166 11/25 (44%)
TM helix 4 346..362 CDD:320166 9/15 (60%)
TM helix 5 384..413 CDD:320166 9/28 (32%)
TM helix 6 433..460 CDD:320166 8/29 (28%)
TM helix 7 470..495 CDD:320166 7/35 (20%)
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 499..504 0/4 (0%)
PDZ-binding 535..537
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D509772at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.