DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smo and sfrp1b

DIOPT Version :9

Sequence 1:NP_523443.1 Gene:smo / 33196 FlyBaseID:FBgn0003444 Length:1036 Species:Drosophila melanogaster
Sequence 2:NP_001077040.1 Gene:sfrp1b / 798564 ZFINID:ZDB-GENE-061103-1 Length:300 Species:Danio rerio


Alignment Length:189 Identity:41/189 - (21%)
Similarity:61/189 - (32%) Gaps:42/189 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 DDKPWFDGLDSRHIQCVRRAR----CYPTSNATNTCFG-SKLPYELSSLDLTDFHTEKELNDKLN 128
            :|..|......:|..||....    |:      |..:| ..||      :|.|..|..|:..:..
Zfish    27 EDYIWPPDSSDKHPPCVDIPEDLRLCF------NVGYGRMMLP------NLLDHETIAEVKQQAV 79

  Fly   129 DYYALKHVPKCWAAIQPFLCAVFKPKCEKINGEDMVYLPSYEMCRITMEPCRILYNTTFF--PKF 191
            .:..|.| ..|....|..||::|.|.|     .|....|....|....:.|..:.....|  |:.
Zfish    80 SWVPLVH-KACHKGTQVLLCSLFAPVC-----LDRPLYPCRWFCEAVRDSCAPIMQAFGFPWPEM 138

  Fly   192 LRCNETLFPTKCTNGARGMKFNGTGQ-CLSPLVPTDTSASYYPGIEGCGVRCKDPLYTD 249
            |||::  ||              .|: |:|.............|.......|::.:.||
Zfish   139 LRCDK--FP--------------LGEVCISSNATKSNETDLIAGGSSVCPACENEMKTD 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smoNP_523443.1 CRD_SMO 86..221 CDD:143560 31/142 (22%)
Frizzled 246..568 CDD:279827 2/4 (50%)
sfrp1bNP_001077040.1 CRD_SFRP1 36..159 CDD:143552 35/156 (22%)
NTR_Sfrp1_like 170..292 CDD:239635 3/12 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.