DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smo and sfrp2

DIOPT Version :10

Sequence 1:NP_523443.1 Gene:smo / 33196 FlyBaseID:FBgn0003444 Length:1036 Species:Drosophila melanogaster
Sequence 2:NP_001070852.2 Gene:sfrp2 / 566878 ZFINID:ZDB-GENE-061013-293 Length:294 Species:Danio rerio


Alignment Length:177 Identity:37/177 - (20%)
Similarity:59/177 - (33%) Gaps:39/177 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 RRARCYPTSNATNTCFGSKLPYELSSLDLTDFHTEKELNDKLNDYYALKHVP----KCWAAIQPF 146
            :::.|.|.......|.    ..|.:::.|.:....:.:|:.|..  |....|    :|....:.|
Zfish    34 KKSNCKPIPTNLLLCH----DIEYTNMRLPNLLGHETMNEVLQQ--ASSWTPLVQKQCHPDTKKF 92

  Fly   147 LCAVFKPKCEKINGEDMVYLPSYEMCRITMEPCRILYNTTFF--PKFLRCNETLFPTKCTNGARG 209
            ||::|.|.|  ::..|....|...:|......|..:.....|  |..|.|..  ||.        
Zfish    93 LCSLFAPVC--LDDLDEPIQPCRSLCESVKSGCAPVMAAFGFPWPDMLDCRR--FPL-------- 145

  Fly   210 MKFNGTGQCLSP-----LVPTDTSASYYPGIEGCGVRCKDPLYTDDE 251
                ....|:.|     |||.....   |.:  |.. ||:....|:|
Zfish   146 ----DNDLCIPPAGADALVPVTKEV---PRV--CDA-CKEKPENDNE 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smoNP_523443.1 CRD_SMO 86..221 CDD:143560 27/140 (19%)
7tmF_SMO_homolog 245..568 CDD:320158 2/7 (29%)
TM helix 1 254..279 CDD:320158
TM helix 2 289..310 CDD:320158
TM helix 3 340..366 CDD:320158
TM helix 4 382..398 CDD:320158
TM helix 5 420..449 CDD:320158
TM helix 6 471..498 CDD:320158
TM helix 7 529..554 CDD:320158
sfrp2NP_001070852.2 CRD_SFRP2 34..161 CDD:143555 29/148 (20%)
NTR_Sfrp1_like 167..294 CDD:239635 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.