DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smo and fz

DIOPT Version :9

Sequence 1:NP_523443.1 Gene:smo / 33196 FlyBaseID:FBgn0003444 Length:1036 Species:Drosophila melanogaster
Sequence 2:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster


Alignment Length:598 Identity:155/598 - (25%)
Similarity:264/598 - (44%) Gaps:124/598 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PINGTLNYR----LYAKKGRDDKPWFDGLDSRHIQCVRRARCYPTSNATNTCFGSKLPYELSSLD 113
            |::.:..||    |.|..|.:    .|||...:       ||.|.:  .:.|  ..:||.::.:.
  Fly    23 PLDASPYYRSGGGLMASSGTE----LDGLPHHN-------RCEPIT--ISIC--KNIPYNMTIMP 72

  Fly   114 LTDFHT-EKELNDKLNDYYALKHVPKCWAAIQPFLCAVFKPKCEKINGEDMVYLPSYEMCRITME 177
            ....|| ::|...:::.:..|..: .|...:|.|||:::.|.|..:...    :|.   ||...|
  Fly    73 NLIGHTKQEEAGLEVHQFAPLVKI-GCSDDLQLFLCSLYVPVCTILERP----IPP---CRSLCE 129

  Fly   178 PCRI------LYNTTFFPKFLRCNETLFPTKCTNGARGM--KFNGTGQCLSPLVPTD-----TSA 229
            ..|:      .||.. :|:.|.|::  ||   .:|...:  ..|.|....:...||.     |:.
  Fly   130 SARVCEKLMKTYNFN-WPENLECSK--FP---VHGGEDLCVAENTTSSASTAATPTRSVAKVTTR 188

  Fly   230 SYYPGIEG--------------------------------CGVRCKDPLYTDDEHRQIHKLIG-W 261
            .:..|:|.                                ||..|....:.:.|...:...:| |
  Fly   189 KHQTGVESPHRNIGFVCPVQLKTPLGMGYELKVGGKDLHDCGAPCHAMFFPERERTVLRYWVGSW 253

  Fly   262 AGSICLLSNLFVVSTFFIDWKNANKYPAVIVFYINLCFLIACVGWLLQFTSGSREDIVCR----- 321
            | ::|:.|.||.|.||.|| .:..:||...:.::.:|:|:  ||.......|:.:.:.||     
  Fly   254 A-AVCVASCLFTVLTFLID-SSRFRYPERAIVFLAVCYLV--VGCAYVAGLGAGDSVSCREPFPP 314

  Fly   322 --KDGTLR-HSEPTAG--ENLSCIVIFVLVYYFLTAGMVWFVFLTYAWHWRA---MGHVQDRIDK 378
              |.|.|: .|..|.|  :..||.|:|:.:|:...|...|:..|.:||...|   .||  :.|:.
  Fly   315 PVKLGRLQMMSTITQGHRQTTSCTVLFMALYFCCMAAFAWWSCLAFAWFLAAGLKWGH--EAIEN 377

  Fly   379 KGSYFHLVAWSLPLVLTITTMAFSEVDGNSIVGICFVGYIN-HSMRAGLLLGPLCGVILIGGYFI 442
            |...||||||::|.:.||:.:|.::|:|:.:.|:||||.:: ||:.|.|:| |||..:.||..|:
  Fly   378 KSHLFHLVAWAVPALQTISVLALAKVEGDILSGVCFVGQLDTHSLGAFLIL-PLCIYLSIGALFL 441

  Fly   443 TRGMVMLFGLKH-FANDIKSTSASNKIHLIIMRMGVCALLTLVFILVAI---ACHVTEFRHADEW 503
            ..|.:.||.::. ...|.|.|   :|:..:::|:|   ..:.:|||.|:   .|...|:.:.|||
  Fly   442 LAGFISLFRIRTVMKTDGKRT---DKLERLMLRIG---FFSGLFILPAVGLLGCLFYEYYNFDEW 500

  Fly   504 AQSFRQFIICKISSVFEEKSSCRI-------ENRPSVGVLQLHLLCLFSSGIVMSTWCWTPSSIE 561
            ...:.: .|||..|:     .|..       |.||...:..:..||....|:..|.|.::..::.
  Fly   501 MIQWHR-DICKPFSI-----PCPAARAPGSPEARPIFQIFMVKYLCSMLVGVTSSVWLYSSKTMV 559

  Fly   562 TWKRYIRKKCGKE 574
            :|:.::.:..|||
  Fly   560 SWRNFVERLQGKE 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smoNP_523443.1 CRD_SMO 86..221 CDD:143560 32/143 (22%)
Frizzled 246..568 CDD:279827 103/347 (30%)
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 30/140 (21%)
Frizzled 237..564 CDD:279827 103/345 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438644
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11309
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.