DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smo and frzb

DIOPT Version :9

Sequence 1:NP_523443.1 Gene:smo / 33196 FlyBaseID:FBgn0003444 Length:1036 Species:Drosophila melanogaster
Sequence 2:NP_001005438.1 Gene:frzb / 448021 XenbaseID:XB-GENE-481353 Length:319 Species:Xenopus tropicalis


Alignment Length:115 Identity:28/115 - (24%)
Similarity:41/115 - (35%) Gaps:32/115 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 FLCAVFKPKCEKINGEDMVYLPSYEMC---RITMEPCRILYNTTFFPKFLRCNETLFPTKCTNGA 207
            ||||::.|.| .|:.:.....|...:|   |...||..|.|..| :|:.|.|.|           
 Frog    83 FLCAMYAPIC-TIDFQHEPIKPCKSVCERARAGCEPILIKYRHT-WPESLACEE----------- 134

  Fly   208 RGMKFNGTGQCLSP--LVPTDTSASYYPGIE------GCG------VRCK 243
              :.....|.|:||  ::..:......|...      .||      .:||
 Frog   135 --LPVYDRGVCISPEAIITVEQGTDSMPDFPMDSNNGNCGSTAGEHCKCK 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smoNP_523443.1 CRD_SMO 86..221 CDD:143560 21/77 (27%)
Frizzled 246..568 CDD:279827
frzbNP_001005438.1 CRD_SFRP3 28..153 CDD:143550 23/84 (27%)
NTR_Sfrp3_like 189..299 CDD:239636
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.