DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smo and Corin

DIOPT Version :9

Sequence 1:NP_523443.1 Gene:smo / 33196 FlyBaseID:FBgn0003444 Length:1036 Species:Drosophila melanogaster
Sequence 2:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster


Alignment Length:171 Identity:43/171 - (25%)
Similarity:66/171 - (38%) Gaps:27/171 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 CYPTSNATNTCFGSKLPYELSSL-DLTDFHTEKELNDKLNDYYALKHVPKCWAAIQPFLCAVFKP 153
            |.|.  ....|.|.::||..:.. :......:.|....|:.|.||..| :|:..:..|||.:|.|
  Fly   779 CLPI--IVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDV-RCYELVSLFLCTLFVP 840

  Fly   154 KCEKINGEDMVYLPSYE-MCRITMEPCRILYNT--TFFPKFLRCNETLFPTKCTNGARGMKFNGT 215
            ||    |:....:|..: :|..||..|...::.  ...|::|.|.  ||          ..|..:
  Fly   841 KC----GQSGATVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCK--LF----------KDFPSS 889

  Fly   216 GQCLS-PLVPTDTSASYYPGIEG--CGV-RCKDPLYTDDEH 252
            ..|:. ..|.....|:.:|..:|  |.. ||....|..|.|
  Fly   890 EDCVG
LDEVREVMRAATHPKCDGFQCDQNRCLPQEYVCDGH 930

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smoNP_523443.1 CRD_SMO 86..221 CDD:143560 33/135 (24%)
Frizzled 246..568 CDD:279827 3/7 (43%)
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 33/133 (25%)
LDLa 911..942 CDD:238060 7/20 (35%)
LDLa 945..979 CDD:238060
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.