DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smo and CG1632

DIOPT Version :9

Sequence 1:NP_523443.1 Gene:smo / 33196 FlyBaseID:FBgn0003444 Length:1036 Species:Drosophila melanogaster
Sequence 2:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster


Alignment Length:360 Identity:70/360 - (19%)
Similarity:105/360 - (29%) Gaps:125/360 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   697 AEMKTKVASRSRGKHGGSSSNRRTQRRRDYIAAATGKSSRRRESSTSVESQVIALKKT------T 755
            ::||   .||...|...:.|...|......::||..|::....|:.:.|..:.|..|.      :
  Fly    10 SQMK---KSRDADKSSATLSATNTNANAVNLSAADKKNNNNNCSNRNKEKSMQANGKNWKGIVQS 71

  Fly   756 YPNASHKVGVFA-------------HHSSKKQHNYTSSMKRRTANAGLDPSILNEFLQKNGDFIF 807
            .||.|..||..|             ||.....|...|:.......|||          .||.   
  Fly    72 NPNPSGGVGTTAQPPKVFHNTRCTRHHKPHHSHGNGSAASAVGGAAGL----------ANGP--- 123

  Fly   808 PFLQNQDMSSSSEEDNSRASQKIQDLNVVVKQQEISEDDHDGIKIEELPNSKQVALENFLKNIKK 872
            |....|......|.|..|..::.:|          .|.|.:                       :
  Fly   124 PMEATQQRERERERDRDRERERERD----------RERDRE-----------------------R 155

  Fly   873 SNESNSNRHSRNSARSQSKKSQKRHLKNPAADLDFRKDCVKYRSNDSLSCSSEELDVALDVGSLL 937
            ..|...:.|..|....:..:|..      :.|.|.|  ..:.:..|...|.     .|:..|.|:
  Fly   156 EREHQLHMHQHNHGLRRKSESVL------STDSDIR--FTRRKLGDGQKCG-----CAVIAGFLI 207

  Fly   938 NSSFSGI--SMGKPHSR----------------NSKTSCDVGIQANPFELVPSYGEDELQQAMRL 984
            ....:||  .:|..:.|                |.|.|.::   ||             |.:||.
  Fly   208 ALLVAGIFVYVGYTYFRPEPLPDRVFRGRFMVLNDKWSMEL---AN-------------QNSMRF 256

  Fly   985 LNAASRQRTEAAN---------EDFGGTELQGLLG 1010
            .:.| |...|..|         |.:.|:|:..|.|
  Fly   257 QHKA-RDYRERINLTLRRSDLREAYEGSEILALDG 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smoNP_523443.1 CRD_SMO 86..221 CDD:143560
Frizzled 246..568 CDD:279827
CG1632NP_001245577.1 SEA 232..327 CDD:279699 17/76 (22%)
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.