DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smo and Sfrp2

DIOPT Version :9

Sequence 1:NP_523443.1 Gene:smo / 33196 FlyBaseID:FBgn0003444 Length:1036 Species:Drosophila melanogaster
Sequence 2:NP_001094170.1 Gene:Sfrp2 / 310552 RGDID:735163 Length:295 Species:Rattus norvegicus


Alignment Length:118 Identity:29/118 - (24%)
Similarity:51/118 - (43%) Gaps:10/118 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 RRARCYPTSNATNTCFGSKLPYELSSL-DLTDFHTEKELNDKLNDYYALKHVPKCWAAIQPFLCA 149
            :|:.|.|.......|.|  :.|:...| :|....|.||:.::...:..|. :.:|....:.|||:
  Rat    36 KRSNCKPIPANLQLCHG--IEYQNMRLPNLLGHETMKEVLEQAGAWIPLV-MKQCHPDTKKFLCS 97

  Fly   150 VFKPKCEKINGEDMVYLPSYEMCRITMEPCRILYNTTFF--PKFLRCNETLFP 200
            :|.|.|  ::..|....|.:.:|....:.|..:.:...|  |..|.|:.  ||
  Rat    98 LFAPVC--LDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDR--FP 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smoNP_523443.1 CRD_SMO 86..221 CDD:143560 29/118 (25%)
Frizzled 246..568 CDD:279827
Sfrp2NP_001094170.1 CRD_SFRP2 36..163 CDD:143555 29/118 (25%)
NTR_Sfrp1_like 169..295 CDD:239635
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.