DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smo and sfrp-1

DIOPT Version :9

Sequence 1:NP_523443.1 Gene:smo / 33196 FlyBaseID:FBgn0003444 Length:1036 Species:Drosophila melanogaster
Sequence 2:NP_500977.2 Gene:sfrp-1 / 177401 WormBaseID:WBGene00022242 Length:314 Species:Caenorhabditis elegans


Alignment Length:148 Identity:33/148 - (22%)
Similarity:54/148 - (36%) Gaps:31/148 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 RCYPTSNATNTCFG-----SKLPYELSSLDLTDFHTEKELNDKLNDYYALKHVPKCWAAIQPFLC 148
            :|....:..:.|.|     .:||      ::.:..|..|......|:.:|..: .|....|.|||
 Worm    36 KCVDIPSNLSICNGIEYTQMRLP------NILEHETVSEAIHASKDWESLLRL-NCHPDTQRFLC 93

  Fly   149 AVFKPKCEKINGEDMVYLPSYEMCRITMEPC-RILYNTTF-FPKFLRCNETLFPTKCTNGARGMK 211
            ::|.|.|  :...|.:.||...:|....:.| ..:.|..| :|:.|.|.               |
 Worm    94 SLFAPVC--LMQMDRLILPCKSLCMAVKQGCENRMANYGFPWPEMLSCE---------------K 141

  Fly   212 FNGTGQCLSPLVPTDTSA 229
            |.....|:.|:.|....|
 Worm   142 FEDDDMCIKPMQPAKPPA 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smoNP_523443.1 CRD_SMO 86..221 CDD:143560 30/138 (22%)
Frizzled 246..568 CDD:279827
sfrp-1NP_500977.2 CRD_FZ 37..161 CDD:382974 33/147 (22%)
NTR_Sfrp1_like 162..283 CDD:239635
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.