DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smo and Fzd8

DIOPT Version :9

Sequence 1:NP_523443.1 Gene:smo / 33196 FlyBaseID:FBgn0003444 Length:1036 Species:Drosophila melanogaster
Sequence 2:NP_032084.2 Gene:Fzd8 / 14370 MGIID:108460 Length:685 Species:Mus musculus


Alignment Length:594 Identity:134/594 - (22%)
Similarity:216/594 - (36%) Gaps:176/594 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 TEKELNDKLNDYYALKHVPKCWAAIQPFLCAVFKPKCEKINGEDMVYLPSYEMCRITMEPCR--- 180
            |:.|...:::.::.|..: :|...::.|||:::.|.|          |..|:.   .:.|||   
Mouse    61 TQDEAGLEVHQFWPLVEI-QCSPDLKFFLCSMYTPIC----------LEDYKK---PLPPCRSVC 111

  Fly   181 ---------ILYNTTF-FPKFLRC----------------NETLFPTKCTN-------------- 205
                     ::....| :|..:||                |.|...|...:              
Mouse   112 ERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPPPGEQ 176

  Fly   206 -----------GA----RGMKFNGTG---------------------------QCLSPLVPTDTS 228
                       ||    ||....|:|                           ||.:|:|  ..|
Mouse   177 PPSGSGHSRPPGARPPHRGGSSRGSGDAAAAPPSRGGKARPPGGGAAPCEPGCQCRAPMV--SVS 239

  Fly   229 ASYYP--------GIEGCGVRCKDPLYTDDEHRQIHKLIGWAGSICLLSNLFVVSTFFIDWKNAN 285
            :..:|        .|..|.:.|.:|.::.||.......||....:|.:|....||||.||.:.. 
Mouse   240 SERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFLIDMERF- 303

  Fly   286 KYPAVIVFYINLCFLIACVGWLLQFTSGSREDIVCR-----------KDGTLRHSEPTAGENLS- 338
            |||...:.:::.|:|...||:|::..:| .|.:.|.           ..|........||...| 
Mouse   304 KYPERPIIFLSACYLFVSVGYLVRLVAG-HEKVACSGGAPGAGGAGGAGGAAAAGAGAAGAGASS 367

  Fly   339 --------------------------CIVIFVLVYYFLTAGMVWFVFLTYAWHWRA-MGHVQDRI 376
                                      |.|:|:|||:|..|..:|:|.|:..|...| |....:.|
Mouse   368 PGARGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAI 432

  Fly   377 DKKGSYFHLVAWSLPLVLTITTMAFSEVDGNSIVGICFVGYINHSMRAGLLLGPLCGVILIGGYF 441
            .....||||.||.:|.|.:|..:|.|.|||:.:.|||:||..:.....|.:|.||...:.||..|
Mouse   433 AGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRGFVLAPLVIYLFIGTMF 497

  Fly   442 ITRGMVMLFGLKHFANDIKSTSASNKIHLIIMRMGVCALLTLVFILVAIACHVTEFRHADEWAQS 506
            :..|.|.||.::.........:.::|:..:::|:|:..:|..|...|.:||...|..:...|   
Mouse   498 LLAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFYEQHNRPRW--- 559

  Fly   507 FRQFIICKISSVFEEKSSCRI--------ENRPSVGVLQL-HLLCLFSSGIVMSTWCWTPSSIET 562
                         |...:|..        ..||...|..| :.:||. .||....|.|:..::|:
Mouse   560 -------------EATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLV-VGITSGVWVWSGKTLES 610

  Fly   563 WKRYIRKKC 571
            |:....:.|
Mouse   611 WRALCTRCC 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smoNP_523443.1 CRD_SMO 86..221 CDD:143560 29/186 (16%)
Frizzled 246..568 CDD:279827 96/369 (26%)
Fzd8NP_032084.2 CRD_FZ8 31..155 CDD:143570 19/107 (18%)
Palmitate-binding groove 71..78 1/6 (17%)
Wnt-binding 95..100 2/14 (14%)
Wnt-binding 147..152 0/4 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..223 7/67 (10%)
7tmF_FZD8 264..616 CDD:320378 97/370 (26%)
TM helix 1 273..298 CDD:320378 8/24 (33%)
TM helix 2 307..328 CDD:320378 5/20 (25%)
TM helix 3 395..417 CDD:320378 10/21 (48%)
TM helix 4 438..454 CDD:320378 9/15 (60%)
TM helix 5 476..499 CDD:320378 7/22 (32%)
TM helix 6 529..554 CDD:320378 8/24 (33%)
TM helix 7 577..602 CDD:320378 8/25 (32%)
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 606..611 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 631..656
PDZ-binding 683..685
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D509772at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.