Sequence 1: | NP_523443.1 | Gene: | smo / 33196 | FlyBaseID: | FBgn0003444 | Length: | 1036 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571933.1 | Gene: | sfrp5 / 117510 | ZFINID: | ZDB-GENE-011108-2 | Length: | 310 | Species: | Danio rerio |
Alignment Length: | 214 | Identity: | 44/214 - (20%) |
---|---|---|---|
Similarity: | 73/214 - (34%) | Gaps: | 59/214 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 TTPASAQQSDVELEPINGTLNYRLYAKKGRDDKPWFDGLDSRHIQCVRRARCYPTSNATNTCFG- 102
Fly 103 ----SKLPYELSSLDLTDFHTEKELNDKLNDYYALKHVPKCWAAIQPFLCAVFKPKCEKINGEDM 163
Fly 164 VYLPSYEMCRITMEPCRILYNTTFF--PKFLRC------NETLFPTKCTNGARGMKFNGTGQCLS 220
Fly 221 PLVP-------TDTSASYY 232 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
smo | NP_523443.1 | CRD_SMO | 86..221 | CDD:143560 | 31/147 (21%) |
Frizzled | 246..568 | CDD:279827 | |||
sfrp5 | NP_571933.1 | CRD_SFRP5 | 46..172 | CDD:143553 | 33/164 (20%) |
NTR_Sfrp1_like | 177..302 | CDD:239635 | 5/20 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |