DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smo and mfrp

DIOPT Version :9

Sequence 1:NP_523443.1 Gene:smo / 33196 FlyBaseID:FBgn0003444 Length:1036 Species:Drosophila melanogaster
Sequence 2:XP_009289590.1 Gene:mfrp / 101885305 ZFINID:ZDB-GENE-160728-150 Length:572 Species:Danio rerio


Alignment Length:146 Identity:34/146 - (23%)
Similarity:58/146 - (39%) Gaps:45/146 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 DGLDSRHIQCVRRARCYPTSNATNTC------FGSKLPYELSS-----LDLTDFHTEKELNDKLN 128
            ||.|..|  |:...  ||.  .|::|      ....|.|.|:|     |.|:|   ::|....|:
Zfish   440 DGADEHH--CMNST--YPP--FTSSCELIQVEMCRDLSYNLTSFPNIWLSLSD---QREAASILH 495

  Fly   129 DYYALKHVPKCWAAIQPFLCAVFKPKCEKINGEDMVYLPSYEMCRITMEPCRILYNTTFFPKFLR 193
            .|..|..:| |:.:.:..:|.:|.|:|...:|              .::.|:.:.:|.    .|:
Zfish   496 KYRVLVDLP-CFESFRQLVCGMFLPRCSPQSG--------------VLQLCQSVCSTA----ELQ 541

  Fly   194 CNETL------FPTKC 203
            |:..|      :|..|
Zfish   542 CSPALSLFSLNWPFNC 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smoNP_523443.1 CRD_SMO 86..221 CDD:143560 29/135 (21%)
Frizzled 246..568 CDD:279827
mfrpXP_009289590.1 CUB 138..248 CDD:238001
LDLa 256..290 CDD:238060
CUB 297..405 CDD:238001
LDLa 413..447 CDD:238060 4/8 (50%)
Fz 459..563 CDD:279700 26/121 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.