DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smo and Fzd7

DIOPT Version :9

Sequence 1:NP_523443.1 Gene:smo / 33196 FlyBaseID:FBgn0003444 Length:1036 Species:Drosophila melanogaster
Sequence 2:NP_001258114.1 Gene:Fzd7 / 100360552 RGDID:2321905 Length:572 Species:Rattus norvegicus


Alignment Length:525 Identity:132/525 - (25%)
Similarity:225/525 - (42%) Gaps:109/525 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 HTEKE-LNDKLNDYYALKHVPKCWAAIQPFLCAVFKPKCEKINGEDMVYLPSYEMCRITMEPCRI 181
            ||.:| ...:::.:|.|..| :|...::.|||:::.|.|..:   |....|...:|....:.|..
  Rat    73 HTNQEDAGLEVHQFYPLVKV-QCSPELRFFLCSMYAPVCTVL---DQAIPPCRSLCERARQGCEA 133

  Fly   182 LYNTTFF--PKFLRCNETLFPT----------KCTNGARGMKFNGTGQCLSPLVPTDTSASYYP- 233
            |.|...|  |:.|||..  ||.          ..::|:.|...:.|....:|.:|.....:..| 
  Rat   134 LMNKFGFQWPERLRCEN--FPVHGAGEICVGQNTSDGSGGAGGSPTAYPTAPYLPDPPFTAMSPS 196

  Fly   234 ---------------------------GIEGCGVRCKDP------LYTDDEHRQIHKLIGWAG-- 263
                                       |...||..| :|      :|..:|.|:..:|  |.|  
  Rat   197 DGRGRWSFPFSCPRQLKVPPYLGYRFLGERDCGAPC-EPGRANGLMYFKEEERRFARL--WVGVW 258

  Fly   264 -SICLLSNLFVVSTFFIDWKNANKYPAVIVFYINLCFLIACV----GWLLQFTSGSREDIVC--- 320
             .:|..|.||.|.|:.:|.:..: ||...:.:::.|:.:..|    |:||:      :..||   
  Rat   259 SVLCCASTLFTVLTYLVDMRRFS-YPERPIIFLSGCYFMVAVAHVAGFLLE------DRAVCVER 316

  Fly   321 -RKDGTLRHSEPTAGENLSCIVIFVLVYYFLTAGMVWFVFLTYAWHWRA---MGHVQDRIDKKGS 381
             ..||....::.|..|  .|.::|:::|:|..|..:|:|.|:..|...|   .||  :.|:....
  Rat   317 FSDDGYRTVAQGTKKE--GCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGH--EAIEANSQ 377

  Fly   382 YFHLVAWSLPLVLTITTMAFSEVDGNSIVGICFVGYINHSMRAGLLLGPLCGVILIGGYFITRGM 446
            ||||.||::|.|.|||.:|..:|||:.:.|:|:||..:.....|.:|.||...:.||..|:..|.
  Rat   378 YFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFLLAGF 442

  Fly   447 VMLFG----LKHFANDIKSTSASNKIHLIIMRMGVCALLTLVFILVAIACHVTEFRHADEWAQSF 507
            |.||.    :||      ..:.:.|:..:::|:||.::|..|...:.:||:..|....:.|.   
  Rat   443 VSLFRIRTIMKH------DGTKTEKLEKLMVRIGVFSVLYTVPATIVLACYFYEQAFREHWE--- 498

  Fly   508 RQFII--CKISSV------FEEKSSCRIENRPSVGVLQLHLLCLFSSGIVMSTWCWTPSSIETWK 564
            |.:::  ||..:|      |...|       |...|..:..|.....||....|.|:..::::|:
  Rat   499 RTWLLQTCKSYAVPCPPGHFSPMS-------PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWR 556

  Fly   565 RYIRK 569
            |:..:
  Rat   557 RFYHR 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smoNP_523443.1 CRD_SMO 86..221 CDD:143560 28/115 (24%)
Frizzled 246..568 CDD:279827 96/347 (28%)
Fzd7NP_001258114.1 CRD_FZ7 45..169 CDD:143575 25/101 (25%)
7tmF_FZD7 241..571 CDD:320374 96/350 (27%)
TM helix 1 251..275 CDD:320374 9/25 (36%)
TM helix 2 284..305 CDD:320374 2/20 (10%)
TM helix 3 335..357 CDD:320374 7/21 (33%)
TM helix 4 378..394 CDD:320374 10/15 (67%)
TM helix 5 416..439 CDD:320374 7/22 (32%)
TM helix 6 470..492 CDD:320374 7/21 (33%)
TM helix 7 521..546 CDD:320374 6/31 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.