DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3345 and LOC1270819

DIOPT Version :10

Sequence 1:NP_608509.1 Gene:CG3345 / 33192 FlyBaseID:FBgn0031240 Length:666 Species:Drosophila melanogaster
Sequence 2:XP_309540.3 Gene:LOC1270819 / 1270819 VectorBaseID:AGAMI1_014081 Length:685 Species:Anopheles gambiae


Alignment Length:37 Identity:10/37 - (27%)
Similarity:15/37 - (40%) Gaps:10/37 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 LLAISQRQCSEAWFGLTTPENICAQRGKNGDLCTGDS 143
            ||:|.:|        :||..|  .|...:..:.|..|
Mosquito    47 LLSICER--------VTTARN--PQTPTSSPIATSSS 73

Return to query results.
Submit another query.