DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and PFA4

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_014640.1 Gene:PFA4 / 854159 SGDID:S000005363 Length:378 Species:Saccharomyces cerevisiae


Alignment Length:385 Identity:81/385 - (21%)
Similarity:137/385 - (35%) Gaps:103/385 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 GLQLPLHPLQIFGWLVLLLFGVASYWVLIPAFHARIQGPLYGLITGLYLVHIASHLTALLTDPAD 169
            |:.:|...:...|      :| |.|::|........|......::.::|    |:..|:.|:|. 
Yeast    11 GIAIPTFLISFIG------YG-AHYFILSNFLSVPKQITFEFCLSMIWL----SYYLAICTNPG- 63

  Fly   170 KELRRVHRNDRIVPEFDRSKHSHVIENGRCHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLNHC 234
                      |.:|.:   |....|....|..|. .....|:.||..||:||...||||.|..:|
Yeast    64 ----------RPLPNY---KPPPDIWRNFCKKCQ-SYKPERSHHCKTCNQCVLMMDHHCPWTMNC 114

  Fly   235 IGSRNYVAFLMCVVSAVVATLVIVAAVVAQIVFYYIQPDWLSFYWCPTESSH-TIES--GDFINI 296
            :|..||..||..:...:|.|.|:......:|.|.:.|.....:::..:|... ||.|  ..|:.:
Yeast   115 VGFANYPHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLL 179

  Fly   297 TLS----------LSNGTMMLIEQHTSEEDVHQEMWDEEQANMTIST---LPTLLENFTAII-EA 347
            |::          :.||...:            |.||.::.....::   ...|::|...|. |:
Yeast   180 TITILFLRCLFNQILNGRSQI------------ESWDMDRLESLFNSGRLTQKLIDNTWRIYPES 232

  Fly   348 SATRPGISPTNH-TETQPVVTGIGLNETI---FMFLLGVLGLLAAVSAGLLLHLCFFHIYISFLG 408
            .:.:.......| |:.:|     ..:|.:   :.|.|         ....||:|...|:::...|
Yeast   233 RSFQNKKDAEEHLTKKRP-----RFDELVNFPYDFDL---------YTNALLYLGPIHLWLWPYG 283

  Fly   409 LTTYEYIRNHRQAQDAKTKQLLEGAPGVRAPKNGNVHFSA---------SLPEPHNPSKS 459
            :.|                     ..|...||||...:.|         |||.|.:..|:
Yeast   284 VPT---------------------GDGNNFPKNGISKYEANSSLEDHILSLPWPPDGGKT 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 26/82 (32%)
PFA4NP_014640.1 COG5273 1..344 CDD:227598 81/385 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.