Sequence 1: | NP_001245821.1 | Gene: | CG17075 / 33191 | FlyBaseID: | FBgn0031239 | Length: | 968 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_010747.1 | Gene: | PFA5 / 852070 | SGDID: | S000002867 | Length: | 374 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 204 | Identity: | 42/204 - (20%) |
---|---|---|---|
Similarity: | 72/204 - (35%) | Gaps: | 77/204 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 115 IFGWL-VLLLFGVASYWVLIPAFHARIQGPLYGLITGLYLVHIASHLTALLTDPADKELRRVHRN 178
Fly 179 -----DRIVPE--FDRSKHSHVIENGRCHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLNHCIG 236
Fly 237 SRNYVAFL----------------MCVV----------------SAVVATLV-------IVAAVV 262
Fly 263 AQIVFYYIQ 271 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17075 | NP_001245821.1 | zf-DHHC | 199..>282 | CDD:279823 | 26/112 (23%) |
PFA5 | NP_010747.1 | COG5273 | 9..335 | CDD:227598 | 42/204 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |