DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and PFA5

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_010747.1 Gene:PFA5 / 852070 SGDID:S000002867 Length:374 Species:Saccharomyces cerevisiae


Alignment Length:204 Identity:42/204 - (20%)
Similarity:72/204 - (35%) Gaps:77/204 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IFGWL-VLLLFGVASYWVLIPAFHARIQGPLYGLITGLYLVHIASHLTALLTDPADKELRRVHRN 178
            ||.|| :::|.|..:.                        .|:|..|  :|...::::.....:|
Yeast    68 IFIWLQIVILVGPGTQ------------------------PHVAPFL--ILPIASEEKTSNTSQN 106

  Fly   179 -----DRIVPE--FDRSKHSHVIENGRCHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLNHCIG 236
                 |.:||.  :....|.:.|....|....:    .||.|.|....|:.:|||:|.|:...||
Yeast   107 TSVEYDAVVPPKCYQSDPHGYPIWCSECQSLKM----ERTHHSSELGHCIPRFDHYCMWIGTVIG 167

  Fly   237 SRNYVAFL----------------MCVV----------------SAVVATLV-------IVAAVV 262
            ..||..|:                :||.                :.:::|||       :.|:::
Yeast   168 RDNYRLFVQFAAYFSTLLLIMWVSICVYIRIITQHNHNYSPNLNANIISTLVFAILGWLLTASLL 232

  Fly   263 AQIVFYYIQ 271
            |..:||..|
Yeast   233 ASSIFYMSQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 26/112 (23%)
PFA5NP_010747.1 COG5273 9..335 CDD:227598 42/204 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.