DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and ERF2

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_013347.1 Gene:ERF2 / 850947 SGDID:S000004236 Length:359 Species:Saccharomyces cerevisiae


Alignment Length:160 Identity:49/160 - (30%)
Similarity:76/160 - (47%) Gaps:22/160 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 WLVLLLFGVASYWVLIPAFHA----RIQGPLYGLITGLY---LVHIASHLTALLTDPADKELRRV 175
            ||.:|| .:....||...|.|    ..|.....|:...|   ::.:||.:....:||.... |.:
Yeast    77 WLGVLL-AIVCPMVLFSIFEAHKLWHTQNGYKVLVIFFYYFWVITLASFIRTATSDPGVLP-RNI 139

  Fly   176 H----RNDRIVPE-----FDRSKHSHV---IENGRCHLCNIRTSSNRTKHCSVCNKCVGKFDHHC 228
            |    ||:..:|:     .....||.:   |....|..|.| ....|:.|||.||.||...||||
Yeast   140 HLSQLRNNYQIPQEYYNLITLPTHSSISKDITIKYCPSCRI-WRPPRSSHCSTCNVCVMVHDHHC 203

  Fly   229 KWLNHCIGSRNYVAFLMCVVSAVVATLVIV 258
            .|:|:|||.|||..||:.::.|::::::::
Yeast   204 IWVNNCIGKRNYRFFLIFLLGAILSSVILL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 26/60 (43%)
ERF2NP_013347.1 COG5273 47..359 CDD:227598 49/160 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.