DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and ZDHHC12

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_001304944.2 Gene:ZDHHC12 / 84885 HGNCID:19159 Length:322 Species:Homo sapiens


Alignment Length:433 Identity:85/433 - (19%)
Similarity:129/433 - (29%) Gaps:194/433 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GVRSETDHIITISTAGL------------------TESHS-ESPAKGVVTP-VRKPHSLGSEDSP 61
            ||...|.|  |:.|.|:                  |.||| ....:....| ...|.|..:...|
Human    10 GVLVRTGH--TVLTWGITLVLFLHDTDKSADELLATHSHSWNQHLQAFAQPGTHFPTSNCTPTPP 72

  Fly    62 ENIIPGEQAETNKKPLHLCRLSQLVSYQSNIADVQHRKGRRLHGLQLPLHPLQIFGWLVLLLFGV 126
            ..::||        |..||          :.|..:.|:......|.||         |..||   
Human    73 TPVLPG--------PASLC----------SPASPELRQWEEQGELLLP---------LTFLL--- 107

  Fly   127 ASYWVLIPAFHARIQGPLYGLITGLYLVHIASHLTALLTDPA--------DKELRRVHRNDRIVP 183
                                |:.|..|:::|    ..|.||.        .:||:  .....:||
Human   108 --------------------LVLGSLLLYLA----VSLMDPGYVNVQPQPQEELK--EEQTAMVP 146

  Fly   184 EFDRSKHSHVIENGRCHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLNHCIGSRNYVAFLMCVV 248
            .        .|...||..|.: ....|.:||..|.:||.::||||.|:.:|:|.||:..|::.:.
Human   147 P--------AIPLRRCRYCLV-LQPLRARHCRECRRCVRRYDHHCPWMENCVGERNHPLFVVYLA 202

  Fly   249 SAVVATLVIVAAVVAQIVFYYIQPDWLSFYWCPTESSHTIESGDFINITLSLSNGTMMLIEQHTS 313
            ..:|..|..:....:.:.|:.....||.                        |:|.:.       
Human   203 LQLVVLLWGLYLAWSGLRFFQPWGQWLR------------------------SSGLLF------- 236

  Fly   314 EEDVHQEMWDEEQANMTISTLPTLLENFTAIIEASATRPGISPTNHTETQPVVTGIGLNETIFMF 378
                                               ||                           |
Human   237 -----------------------------------AT---------------------------F 239

  Fly   379 LLGVLGLLAAVSAGLLLHLCFFHIYISFLGLTTYEYIRNHRQA 421
            ||  |.|.:.|::.||:.    |:|:.....||:|:|.:||.|
Human   240 LL--LSLFSLVASLLLVS----HLYLVASNTTTWEFISSHRIA 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 23/82 (28%)
ZDHHC12NP_001304944.2 DHHC <178..272 CDD:388695 33/192 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.