DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and ZDHHC18

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_115659.1 Gene:ZDHHC18 / 84243 HGNCID:20712 Length:388 Species:Homo sapiens


Alignment Length:260 Identity:64/260 - (24%)
Similarity:108/260 - (41%) Gaps:47/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LVLLLFGVASYWVLIPAFHAR---IQGPLYGLITGLYLVHIASHLTALLTDPADKELRRVHRNDR 180
            |:|:|.....::|....:.||   :..|:...|  |:...::..|....|||.......|.....
Human    98 LLLILTTTGLFFVFDCPYLARKLTLAIPIIAAI--LFFFVMSCLLQTSFTDPGILPRATVCEAAA 160

  Fly   181 IVPEFDRSKHS---------HVIENGR------CHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKW 230
            :..:.|.:..|         .|:.||:      |..|.: ....||.|||||:.||.:|||||.|
Human   161 LEKQIDNTGSSTYRPPPRTREVLINGQMVKLKYCFTCKM-FRPPRTSHCSVCDNCVERFDHHCPW 224

  Fly   231 LNHCIGSRNYVAFLMCVVSAVVATLVIVAAVVAQIVFYYIQPDWLSFYWCPTESSHTIESGD--- 292
            :.:|:|.|||..|...::|....|..|.|.||..:.......::||          |::...   
Human   225 VGNCVGRRNYRFFYAFILSLSFLTAFIFACVVTHLTLRAQGSNFLS----------TLKETPASV 279

  Fly   293 ------FINI--TLSLSN-GTMMLIEQHTSEEDVHQEMWDEE---QANMTISTLPTLLENFTAII 345
                  |.:|  .|.||. .|.::....|:.||: :..|..:   :|::...:..:::.|..|::
Human   280 LELVICFFSIWSILGLSGFHTYLVASNLTTNEDI-KGSWSSKRGGEASVNPYSHKSIITNCCAVL 343

  Fly   346  345
            Human   344  343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 31/82 (38%)
ZDHHC18NP_115659.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..67
zf-DHHC 191..314 CDD:279823 41/134 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..388
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.