DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and Zdhhc20

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:XP_006519721.1 Gene:Zdhhc20 / 75965 MGIID:1923215 Length:475 Species:Mus musculus


Alignment Length:402 Identity:79/402 - (19%)
Similarity:130/402 - (32%) Gaps:145/402 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TTAAGLKSGPKGA--YGVRSETDHIITISTAGLTESHSESPAKGVVTPVRKPHS----------- 54
            |..:|::.||.|.  .|||.                 ...|..|....|..|.:           
Mouse    22 TARSGMRGGPGGGPEGGVRG-----------------GPGPGAGRGGVVASPFATACGGGASGAG 69

  Fly    55 ------LGSEDSPENII--PGEQAETNKKPLHLCRLSQLVSYQSNIADVQHRKGRRLHGLQLPLH 111
                  |||....|:..  ||.| :.|..|..|.|..|                           
Mouse    70 KLATGPLGSCGPTESWAAGPGSQ-QRNMAPWTLWRCCQ--------------------------- 106

  Fly   112 PLQIFGWLVLLLFGVASYW------------------------VLIPAFHARIQGPLYGLITGLY 152
              ::.||:.:|.......|                        |.:.|||.            .:
Mouse   107 --RVVGWVPVLFITFVVVWSYYAYVVELCVSTISRTGEKGKTVVYLVAFHL------------FF 157

  Fly   153 LVHIASHLTALLTDPA--DKELRRVH-RNDRIVPEFDRSKHSHVIENGR---------------- 198
            ::.:.|:...:.|.||  .||....: ..:|...||.:.:...::....                
Mouse   158 VMFVWSYWMTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQDILRRAARDLPIYTTSASKAIRY 222

  Fly   199 CHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLNHCIGSRNYVAFLMCVVSAVVATLVIVAAVVA 263
            |..|.: ...:|..|||.|::||.|.||||.|:|:|:|..||..|::.::.:::..|.:.|.|:.
Mouse   223 CEKCQL-IKPDRAHHCSACDRCVLKMDHHCPWVNNCVGFTNYKFFMLFLLYSLLYCLFVAATVLE 286

  Fly   264 QIVFYYI-------------QPDWLSFYWCPTESSHTI----ESGDFINITLSLSNGTMMLI-EQ 310
            ..:.::.             :|..|:|   |:...|.:    .|..|....|||.:....|: :.
Mouse   287 YFIKFWTLCRRKSTENCPKNEPTVLNF---PSAKFHVLFLFFVSAMFFVSVLSLFSYHCWLVGKN 348

  Fly   311 HTSEEDVHQEMW 322
            .|:.|.....|:
Mouse   349 RTTIESFRAPMF 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 27/95 (28%)
Zdhhc20XP_006519721.1 DHHC 111..411 CDD:388695 54/266 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.