DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and Zdhhc16

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_001347605.1 Gene:Zdhhc16 / 74168 MGIID:1921418 Length:377 Species:Mus musculus


Alignment Length:219 Identity:58/219 - (26%)
Similarity:77/219 - (35%) Gaps:64/219 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 PLHLC-RLSQLVSYQSNIADVQHRKGRRLHGLQLPLHPL--QIFG--------------WL---V 120
            |..|| ||..|:.|:.....:.....:|....::.|..|  ..||              ||   |
Mouse    11 PARLCLRLLLLLGYRRRCPPLLRGLVQRWRYGKVCLRSLLYNSFGGSDTAVDAAFEPVYWLVDNV 75

  Fly   121 LLLFGVASYWVLIPAFHARIQGPLY----GLITGLY---------------LVHIASHLTALLTD 166
            :..|||. :.||:......|....|    .||...|               |:.|..|....:|.
Mouse    76 IRWFGVV-FVVLVIVLTGSIVAIAYLCVLPLILRTYSVPRLCWHFFYSHWNLILIVFHYYQAITT 139

  Fly   167 PADKELRRVHRNDRIVPEFDRSKHSHVIENGRCHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWL 231
            |               |.:.....:.:.....|..| |.....||.|||:||:||.|.||||.||
Mouse   140 P---------------PGYPPQGRNDIATVSICKKC-IYPKPARTHHCSICNRCVLKMDHHCPWL 188

  Fly   232 NHCIGSRNYVAF--------LMCV 247
            |:|:|..|:..|        |.||
Mouse   189 NNCVGHYNHRYFFSFCFFMTLGCV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 27/57 (47%)
Zdhhc16NP_001347605.1 DHHC 156..305 CDD:396215 27/58 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.