DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and Zdhhc25

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_081582.1 Gene:Zdhhc25 / 70073 MGIID:1917323 Length:279 Species:Mus musculus


Alignment Length:211 Identity:56/211 - (26%)
Similarity:91/211 - (43%) Gaps:46/211 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 HRKGRRLHGLQLPLHPLQIFGWLVL----LLFGVASY-------WV-----LIPA---FHARIQG 142
            |.......||:.||.......|.:|    :|..:|::       ||     |||:   .:....|
Mouse     8 HGTSEHSAGLETPLQAPNQRCWFILDPIGILCAMAAWALVLSGGWVLFRDLLIPSNNMLYIVANG 72

  Fly   143 PLYGLITGLYLVHIASHLTALLTDPADKELRRVHRNDRIVPEFDRSKHSHVIENGRCHLCNIRTS 207
            .::.|:..|.|   ||||..:||||....|......|.:         |:..:   ||....||:
Mouse    73 VVFHLLASLAL---ASHLRTMLTDPGSVPLGNPPGPDTV---------SYCTD---CHSAIPRTA 122

  Fly   208 SNRTKHCSVCNKCVGKFDHHCKWLNHCIGSRNYVAFLMCVVSAVVATLVIVAAVVAQIVFYYIQP 272
            .    ||:||.:|:.|.||||.|:|:|||..|...||:..:...:.:..::..:...::..|::.
Mouse   123 C----HCTVCQRCIRKNDHHCPWINNCIGEDNQKYFLLFTMYIGLTSTHVLLLLGIPVLCSYMRG 183

  Fly   273 DWLSFYWCPTESSHTI 288
            :|        :||.|:
Mouse   184 EW--------DSSSTV 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 24/82 (29%)
Zdhhc25NP_081582.1 zf-DHHC 109..230 CDD:279823 28/98 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.