DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and Zdhhc6

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_001028745.1 Gene:Zdhhc6 / 66980 MGIID:1914230 Length:413 Species:Mus musculus


Alignment Length:263 Identity:56/263 - (21%)
Similarity:88/263 - (33%) Gaps:108/263 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 PLHP-------LQIFGWLVLLLFGVASYWVLIPAFHARIQGPLYGLITGLYLVHIASHLTALLTD 166
            |||.       :.:..|.|::|:..         |:|...||.:                     
Mouse    48 PLHTTGGSVNFIMLINWTVMILYNY---------FNAMFAGPGF--------------------- 82

  Fly   167 PADKELRRVHRNDRIVPEFDRSKHSHVIENGRCHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWL 231
                    |.|..:  ||  :|:.|..::  .|.:|. ...:.|:.||..||:||.|.||||.|:
Mouse    83 --------VPRGWK--PE--KSQDSMYLQ--YCKVCQ-AYKAPRSHHCRKCNRCVMKMDHHCPWI 132

  Fly   232 NHCIGSRNYVAF----LMCVVSAVVATLVIVAAVVAQIVFYYIQPDWLSFYWCPTESSHTIESGD 292
            |:|.|.:|:.:|    |:..:....|..:.|..:..|:.      :.|||.|...:...:....|
Mouse   133 NNCCGHQNHASFTLFLLLAPLGCTHAAFIFVMTMYTQLY------NRLSFGWNTVKIDMSAARRD 191

  Fly   293 ---------------------------------FINITLSLSNGTMMLIEQHTSEEDVHQEMWDE 324
                                             ||.|.:.|.|.|.:             |.|.|
Mouse   192 PPPIVPFGLAAFAATLFALGLALGTTIAVGMLFFIQIKIILRNKTSI-------------ESWIE 243

  Fly   325 EQA 327
            |:|
Mouse   244 EKA 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 28/86 (33%)
Zdhhc6NP_001028745.1 DHHC 95..241 CDD:366691 37/167 (22%)
SH3_2 317..396 CDD:369452
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9H6R6 410..413
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.