Sequence 1: | NP_001245821.1 | Gene: | CG17075 / 33191 | FlyBaseID: | FBgn0031239 | Length: | 968 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001028745.1 | Gene: | Zdhhc6 / 66980 | MGIID: | 1914230 | Length: | 413 | Species: | Mus musculus |
Alignment Length: | 263 | Identity: | 56/263 - (21%) |
---|---|---|---|
Similarity: | 88/263 - (33%) | Gaps: | 108/263 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 109 PLHP-------LQIFGWLVLLLFGVASYWVLIPAFHARIQGPLYGLITGLYLVHIASHLTALLTD 166
Fly 167 PADKELRRVHRNDRIVPEFDRSKHSHVIENGRCHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWL 231
Fly 232 NHCIGSRNYVAF----LMCVVSAVVATLVIVAAVVAQIVFYYIQPDWLSFYWCPTESSHTIESGD 292
Fly 293 ---------------------------------FINITLSLSNGTMMLIEQHTSEEDVHQEMWDE 324
Fly 325 EQA 327 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17075 | NP_001245821.1 | zf-DHHC | 199..>282 | CDD:279823 | 28/86 (33%) |
Zdhhc6 | NP_001028745.1 | DHHC | 95..241 | CDD:366691 | 37/167 (22%) |
SH3_2 | 317..396 | CDD:369452 | |||
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9H6R6 | 410..413 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |