DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and zdhhc12b

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:XP_021327289.1 Gene:zdhhc12b / 569129 ZFINID:ZDB-GENE-070705-356 Length:270 Species:Danio rerio


Alignment Length:328 Identity:65/328 - (19%)
Similarity:104/328 - (31%) Gaps:136/328 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 DVQHRKGRRLHGLQLPLHPLQIFGWLVLLLFGVASYWVLIPAFHARIQGPLYGLITGLYLVHIAS 158
            |...|:......|.||:..:.:....|||.|.|:   ::.|.|                      
Zfish    31 DTDLRRQEETGELTLPVLFVLLVLVSVLLYFAVS---LMDPGF---------------------- 70

  Fly   159 HLTALLTDPADKE--LRRVHRNDRIVPEFDRSKHSHVIENGRCHLCNIRTSSNRTKHCSVCNKCV 221
                :|||..|.:  |........::|:..:|     |...||..|.:: ...|:|||..|..||
Zfish    71 ----VLTDDCDLQFTLGIAEETQDMIPQTTKS-----IRLRRCGHCLVQ-QPMRSKHCQTCQHCV 125

  Fly   222 GKFDHHCKWLNHCIGSRNYVAFLMCVVSAVVATLVIVAAVVAQIVFYYIQPDWLSFYWCPTESSH 286
            .::||||.|:.:|:|.||:..|            |:..||...::.:.:...|..|         
Zfish   126 RRYDHHCPWIENCVGERNHRWF------------VLYLAVQLVVLLWGLYMAWSGF--------- 169

  Fly   287 TIESGDFINITLSLSNGTMMLIEQHTSEEDVHQEMWDEEQANMTISTLPTLLENFTAIIEASATR 351
                                          .|...|.:        .|.|               
Zfish   170 ------------------------------SHASTWQQ--------WLRT--------------- 181

  Fly   352 PGISPTNHTETQPVVTGIGLNETIFMFLLGVLGLLAAVSAGLLLHLCFFHIYISFLGLTTYEYIR 416
                           .|:         |||...::|.::..:|| |...|:|:..|..||:|::.
Zfish   182 ---------------NGV---------LLGAAAVVAILALTVLL-LLGSHLYLVSLNTTTWEFMS 221

  Fly   417 NHR 419
            .||
Zfish   222 RHR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 24/82 (29%)
zdhhc12bXP_021327289.1 zf-DHHC 97..>171 CDD:307600 27/130 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.