DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and zdhhc20a

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:XP_005172729.1 Gene:zdhhc20a / 561776 ZFINID:ZDB-GENE-070424-38 Length:369 Species:Danio rerio


Alignment Length:233 Identity:50/233 - (21%)
Similarity:85/233 - (36%) Gaps:89/233 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 PLHPLQI----FGWLVLLLFGVASYW---------------------VLIPAFHARIQGPLYGLI 148
            |.|.::.    ..|:.::...:...|                     :.:..|||          
Zfish     3 PSHAVRCCQRGLSWIPVIFINLVVCWSYYAYVVELCIYTIPNVNEQVIYLVVFHA---------- 57

  Fly   149 TGLYLVHIASHLTALLTDP-----------ADKE--------------LRRVHRNDRIVPEFDRS 188
              .:.:.:.|:...:.:.|           |:||              |:||.|.   :|.:..:
Zfish    58 --FFFMFMWSYWKTISSKPTNPSKEFCLPKAEKELYEKEERPEAQQDILKRVARE---LPIYTFT 117

  Fly   189 KHSHVIENGRCHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLNHCIGSRNYVAFLMCVVSAVVA 253
            ....:....||.|    ...:|..|||.|:|||.|.||||.|:|:|:|..||..|::.:..::: 
Zfish   118 GSGAIRYCDRCQL----IKPDRCHHCSTCDKCVLKMDHHCPWVNNCVGFSNYKFFVLFLAYSML- 177

  Fly   254 TLVIVAAVVAQIVFYYIQPDWLSFYW----------CP 281
            ..|.:||.|.|   |:|:      :|          ||
Zfish   178 YCVYIAATVLQ---YFIK------FWTLCRRRAIEHCP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 32/93 (34%)
zdhhc20aXP_005172729.1 zf-DHHC 12..309 CDD:303066 48/224 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.