DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and ZDHHC3

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:XP_016862050.1 Gene:ZDHHC3 / 51304 HGNCID:18470 Length:378 Species:Homo sapiens


Alignment Length:398 Identity:90/398 - (22%)
Similarity:139/398 - (34%) Gaps:167/398 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IFGW-LVLLLFGVASYWVLIPA---FHARIQGPLYGLITGLYLVHIASHLTALLTDPADKELRRV 175
            |..| |||....|..:.:|||:   .::.|.|.::.|:..|.|   |||..|:||||.       
Human    49 IVTWFLVLYAEFVVLFVMLIPSRDYVYSIINGIVFNLLAFLAL---ASHCRAMLTDPG------- 103

  Fly   176 HRNDRIVPEFDRSK---HSHVIENG----RC-HLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLN 232
                 .||:.:.:|   .|..::.|    :| ..|:|:  .:|..|||||.:|:.|.||||.|:|
Human   104 -----AVPKGNATKEFIESLQLKPGQVVYKCPKCCSIK--PDRAHHCSVCKRCIRKMDHHCPWVN 161

  Fly   233 HCIGSRN---YVAFLMCVVSAVVATLVIVAAVVAQIVFYYI---QPDWLSFYWCPTESSHTIESG 291
            :|:|..|   :|.|.|.:....:..|::|.       |:::   :.||.::.....|.:.|    
Human   162 NCVGENNQKYFVLFTMYIALISLHALIMVG-------FHFLHCFEEDWTTYGLNREEMAET---- 215

  Fly   292 DFINITLSLSNGTMMLIEQHTSEEDVHQEMWDEEQANMTISTLPTLLENFTAIIEASATRPGISP 356
               .|:|                   |::|                                 .|
Human   216 ---GISL-------------------HEKM---------------------------------QP 225

  Fly   357 TNHTETQ-----PVVTGIGLNETIFMFLLGVLGLLAAVSAGLLLHLCF----FHIYISFL----- 407
            .|.:.|:     |..|.|                       ||:.|||    |.|:.|.:     
Human   226 LNFSSTECSSFSPPTTVI-----------------------LLILLCFEGLLFLIFTSVMFGTQV 267

  Fly   408 -GLTTYEYIRNHRQAQDAKTKQLLEGAPGVRAPKNGNVHFSASLPEPHNPSKSLPGGQQ---LYC 468
             .:.|.|..|..:|....:.|.|..|..|                         ||...   ||.
Human   268 HSICTDETKRWRKQCPQWRVKGLCAGCCG-------------------------PGELAWPCLYL 307

  Fly   469 CSSAPHPS 476
            ..::|||:
Human   308 LWASPHPN 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 28/89 (31%)
ZDHHC3XP_016862050.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.