DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and zdhhc23b

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_001003757.1 Gene:zdhhc23b / 445301 ZFINID:ZDB-GENE-040808-13 Length:425 Species:Danio rerio


Alignment Length:281 Identity:62/281 - (22%)
Similarity:109/281 - (38%) Gaps:72/281 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 HR-KGRRLHGLQLPLHPLQIFGWLVL-----------LLFGVASYWVLIPAFHARI--QGPLYGL 147
            || |||.|..|.|.|..|....:|.|           |...|.:..|.:......:  :||  ||
Zfish   124 HRKKGRTLFFLGLALFSLFYMFYLFLTQVVPRGEVTELQLAVVTAGVALTVIFLMLTKRGP--GL 186

  Fly   148 --------------------ITGLYLVHIASHLTALLTDPADKELRRVHRNDRIVPEFDRSKHSH 192
                                :.|:|| :.|.|...:.:..|..|    |..:....|    :...
Zfish   187 VRPRPSETHSTVTYHSTPPDVDGVYL-NGARHQVVIGSRVASSE----HTGEPGTEE----EEEG 242

  Fly   193 VIENGRCHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLNHCIGSRNYVAFLMCVVSAVVATLVI 257
            |.:...|.:|.: ....|..||.:|..||.:.||||.|:|.|:|..|:..||:.::..::.::..
Zfish   243 VQKRNWCAVCKV-VRPRRAGHCRICGVCVLRLDHHCVWINSCVGLANHRTFLLTLLFFLLTSIFG 306

  Fly   258 VAAVVAQIVFYYIQPD---WLSFYWCPTESSH-------------TIESGDFIN-ITLSLSNGTM 305
            ::.|:|.:.     ||   ..:.::||...|.             :|.:|..:: :.|.:.|.::
Zfish   307 ISLVLASVC-----PDQRVLTALFYCPDVYSQYSSALCFTCAWYSSIVTGGLLHLLLLQILNISL 366

  Fly   306 MLIEQHT----SEEDVHQEMW 322
            .:.|:..    .|:...:.:|
Zfish   367 NVTEREARLALREKSAQRRLW 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 24/85 (28%)
zdhhc23bNP_001003757.1 7TMR-DISM_7TM <62..179 CDD:284997 15/54 (28%)
zf-DHHC <244..>350 CDD:303066 27/111 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.