DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and zdhhc3a

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_001002725.1 Gene:zdhhc3a / 436998 ZFINID:ZDB-GENE-040718-484 Length:316 Species:Danio rerio


Alignment Length:287 Identity:77/287 - (26%)
Similarity:120/287 - (41%) Gaps:89/287 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 DVQHRKGRRLHGLQLP-----LHPLQIFGWLV--------------LLLFG--VASYWVLIPAFH 137
            ||:    |:..|||.|     .|..|...|.:              |:.|.  |..:.:|||:  
Zfish    10 DVE----RQASGLQPPQCLPSCHERQNSMWFIKDACGIVCAIITWFLVFFAEFVVLFVMLIPS-- 68

  Fly   138 ARIQGPLYGLITG-----LYLVHIASHLTALLTDPADKELRRVHRNDRIVPEFDRSK---HSHVI 194
               :...|.|:.|     |..:.:|||..|:.|||.            .||:.:.:|   .|..:
Zfish    69 ---KNLTYSLVNGTLFNSLAFLALASHFRAMCTDPG------------AVPKGNATKEYIESLQL 118

  Fly   195 ENG----RC-HLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLNHCIGSRN---YVAFLM--CVVS 249
            :.|    :| ..|:|:  .:|..|||||.:|:.|.||||.|:|:|:|..|   :|.|.|  |::|
Zfish   119 KPGQVVYKCPKCCSIK--PDRAHHCSVCKRCIRKMDHHCPWVNNCVGENNQKYFVLFTMYICLIS 181

  Fly   250 AVVATLVIVAAVVAQIVFYYI---QPDWLSFYWCPTESSHTIE--------SGDFINITLSLSNG 303
              :.:||:|       ||:::   :.||..   |.|.|.....        .|....|..|:..|
Zfish   182 --LHSLVMV-------VFHFLNCFEDDWTK---CSTFSPPATVILLILLCFEGLLFLIFTSVMFG 234

  Fly   304 TMM--LIEQHTSEEDVHQE--MWDEEQ 326
            |.:  :....|..|.:.:|  .|::.|
Zfish   235 TQVHSICTDETGIEKLKREDPTWEKTQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 33/91 (36%)
zdhhc3aNP_001002725.1 zf-DHHC 127..251 CDD:279823 42/137 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.