powered by:
Protein Alignment CG17075 and CG4956
DIOPT Version :9
Sequence 1: | NP_001245821.1 |
Gene: | CG17075 / 33191 |
FlyBaseID: | FBgn0031239 |
Length: | 968 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_651428.2 |
Gene: | CG4956 / 43114 |
FlyBaseID: | FBgn0039370 |
Length: | 302 |
Species: | Drosophila melanogaster |
Alignment Length: | 70 |
Identity: | 26/70 - (37%) |
Similarity: | 37/70 - (52%) |
Gaps: | 13/70 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 188 SKHSHVIEN-----GRCHLCNIRTSSN-----RTKHCSVCNKCVGKFDHHCKWLNHCIGSRN--- 239
|..|.|:|. |..||.:..::.. |:.|||:||.|:.|.||||.:...|||.:|
Fly 103 SVDSLVLERQYPVAGEAHLWHYCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRY 167
Fly 240 YVAFL 244
::|||
Fly 168 FLAFL 172
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5273 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR22883 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.