DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and CG17196

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster


Alignment Length:347 Identity:68/347 - (19%)
Similarity:111/347 - (31%) Gaps:126/347 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 HPLQIFGWLV-LLLFGVASYWVLIPAFHARIQGPLYG--LITGLYLVH--IASHLTALLTDPADK 170
            |||.:...|| .:.|.....:.:.|..|   .|.:|.  :|:.::..:  :.:.|....|..|.|
  Fly    24 HPLSVIFLLVSTVFFFTLQVFYVAPDVH---DGFMYKFFVISAIFTTYNILGNLLACYRTSSAVK 85

  Fly   171 ELRRVHRNDRIVPEFDRSKHSHVIENGRCHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLNHCI 235
            .|.:    :|.:|:.......|.     |.:|. :....|:.||::|..|:.|.||||.:...||
  Fly    86 SLPQ----ERQIPKPGTEHLWHY-----CDICQ-KLMPPRSWHCALCKCCILKRDHHCIFAATCI 140

  Fly   236 GSRNYVAFLMCVVSAVVATLVIVAAVVAQIVFYYIQPDWLSFYWCPTESSHTIESGDFINITLSL 300
            |..|:..|.                             ||:||         :..|.|      :
  Fly   141 GHNNHRYFF-----------------------------WLTFY---------LAFGIF------M 161

  Fly   301 SNGTMMLIEQHTSEEDVHQEMWDEEQANMTISTLPTLLENFTAIIEASATRPGISPTNHTETQPV 365
            |..|:.:        ||.:..:              ||....|                      
  Fly   162 SMATLFV--------DVGRSFY--------------LLHRMKA---------------------- 182

  Fly   366 VTGIGLNETI-----FMFLLGVLGLLAAVSAGLLLHLCFFHIYISFLGLTTYEYIRNHRQAQDAK 425
                |...|:     |.::..:|.:.|.....|:|.   |.:.|..|..|.|:....|.......
  Fly   183 ----GFGNTVKSLSYFRYVCLILNIFALGFPALMLR---FQVQILKLNSTYYQISSRHHDLGFRN 240

  Fly   426 TKQLLEG--------APGVRAP 439
            ..||:.|        :|.:|:|
  Fly   241 NCQLIMGQRGLWTFISPSLRSP 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 21/82 (26%)
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 42/225 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.