DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and zgc:77880

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_957185.1 Gene:zgc:77880 / 393865 ZFINID:ZDB-GENE-040426-1901 Length:297 Species:Danio rerio


Alignment Length:169 Identity:49/169 - (28%)
Similarity:79/169 - (46%) Gaps:33/169 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LVLLLFGV--ASY----WVLIPAFHARIQGPLYGLITGLYL-VHIASHLTALLTDPADKELRRVH 176
            |:|..|.|  |.|    :|||||:...:...|:|.:..:.| :.:|.|..|:.:||.        
Zfish    16 LILTYFSVFYADYVVIQYVLIPAYSGSVWCTLHGSVFNIILFLLLACHSKAVFSDPG-------- 72

  Fly   177 RNDRIVP------EFD--RSKHSHVIENG-----RCHLCNIRTSSNRTKHCSVCNKCVGKFDHHC 228
                :||      :|.  ||:.:.:.:.|     .|..|...... |..||.||.:|:.:.||||
Zfish    73 ----MVPLPETAIDFSDLRSQSNRLNDRGCEGWTVCSRCETYRPP-RAHHCRVCQRCIRRMDHHC 132

  Fly   229 KWLNHCIGSRNYVAFLMCVVSAVVATLVIVAAVVAQIVF 267
            .|:|:|:|..|...|:..:....:|:|..:|.||:..|:
Zfish   133 PWINNCVGELNQKYFIQFLFYTGMASLYSMALVVSAWVW 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 24/69 (35%)
zgc:77880NP_957185.1 zf-DHHC 12..>164 CDD:303066 45/160 (28%)
zf-DHHC 103..235 CDD:279823 24/70 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.