DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and zdhhc16b

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:XP_009304660.1 Gene:zdhhc16b / 393316 ZFINID:ZDB-GENE-040426-1301 Length:382 Species:Danio rerio


Alignment Length:156 Identity:41/156 - (26%)
Similarity:62/156 - (39%) Gaps:39/156 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IFGWLVLLLFG---VASYWVLIPAFHARIQGPLYGLITGLYLVH------IASHLTALLTDPADK 170
            :|..||:.|..   |..|..::|...:..  |:|.::..|...|      :..:..|..|.|.  
Zfish    80 VFVCLVMALTSSVVVIVYLCVLPIIFSSY--PVYWILWHLCYGHWNLLMVVFHYYKATTTQPG-- 140

  Fly   171 ELRRVHRNDRIVPEFDRSKHSHVIENGRCHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLNHCI 235
                          |...:.:.:.....|..| |.....||.|||:||:|:.|.||||.|||:|:
Zfish   141 --------------FPPQEKTDIPTVTICKKC-IVPKPARTHHCSICNRCILKMDHHCPWLNNCV 190

  Fly   236 GSRNYVAF-----------LMCVVSA 250
            |..|:..|           :.|.:||
Zfish   191 GHFNHRYFFSFCLFMTMGCVYCSISA 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 26/63 (41%)
zdhhc16bXP_009304660.1 zf-DHHC 83..>206 CDD:327686 37/141 (26%)
zf-DHHC 154..310 CDD:307600 26/64 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.