DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and CG2611

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_610043.1 Gene:CG2611 / 35324 FlyBaseID:FBgn0032871 Length:132 Species:Drosophila melanogaster


Alignment Length:142 Identity:26/142 - (18%)
Similarity:48/142 - (33%) Gaps:46/142 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 PT--ESSHTIE----------SGDFINITLSLSNGTMMLIEQHTSEEDVHQEMWDEEQANMTI-- 331
            ||  ||.|.:.          ||::|.:           :|.....:....|.|.|......:  
  Fly     3 PTNSESRHRLNGGGRSSAPAGSGEYIKV-----------VESQCETDGFVNEQWTEPAMPGPVPW 56

  Fly   332 STLPTLLENFTA--IIEASATRPGISPTNHTETQPVVTGIGLNETIFMFLLGVLGLLAAVSAGLL 394
            .|:..:|..|..  :..|.||...::.|:...:..|            :.||::|.|..:...  
  Fly    57 KTIIIILLLFIGGIVCIAFATLNWVTDTSRERSDRV------------WALGIIGALTFIPGS-- 107

  Fly   395 LHLCFFHIYISF 406
                 :::|:.|
  Fly   108 -----YYVYVLF 114

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity