DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and Dnz1

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster


Alignment Length:229 Identity:53/229 - (23%)
Similarity:93/229 - (40%) Gaps:55/229 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IFGWLVLLLFGVASYWVLIPAFHARIQGPLYGLITGLYLVHIASHLTALLTDPAD---------- 169
            :..|::|... ..|.|:   :||.    .|:..:..|..:   ||..|:.:||..          
  Fly    27 VIRWIILTTM-PGSLWM---SFHV----VLFNTVVFLLAM---SHSKAVFSDPGTVPLPANRLDF 80

  Fly   170 KELRRVHRNDRIVPEFDRSKHSHVIENGRCHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLNHC 234
            .:|...::|:      ....:.|..|...|..|...... |..||.:|.:|:.:.||||.|:|:|
  Fly    81 SDLHTTNKNN------PPPGNGHSSEWTVCTRCETYRPP-RAHHCRICKRCIRRMDHHCPWINNC 138

  Fly   235 IGSRNYVAFLMCVVSAVVATLVIVAAVVAQIVFYYIQPDWLSFYW-CPTESSHTIES-----GDF 293
            :|.||...||..::...:.:|..:|.:|.            |:.| |...|.:.||:     ...
  Fly   139 VGERNQKYFLQFLIYVALLSLYSIALIVG------------SWVWPCEECSQNVIETQLRMIHSV 191

  Fly   294 INITLSLSNG---TMMLIEQHTSEEDVHQEMWDE 324
            |.:.:|...|   |.::::|      :|..::||
  Fly   192 ILMLVSALFGLFVTAIMVDQ------LHAILYDE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 25/83 (30%)
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 38/142 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.