DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and GABPI

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster


Alignment Length:220 Identity:58/220 - (26%)
Similarity:93/220 - (42%) Gaps:56/220 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 WLVLLLFGVASYWVLIPAFHARIQGPL--------YGLI----TGLYLVHIASHLTALL------ 164
            |||..:|    |.::|..|    |.||        |.|:    ..||.::.|..|:.|.      
  Fly   153 WLVFSVF----YMIIIFEF----QVPLLELAPEENYALMFFSCAALYCLYSAKALSPLNLVSAQY 209

  Fly   165 -TDPADK--------------------ELRRV-HRNDRIVPEFDRSKHSHVIENGRCHLCNI--R 205
             |.|.|:                    ::..| ..:|..|.:.|.::.|.:: :|:.::|.|  :
  Fly   210 GTTPKDELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMDTAERSGLM-HGQPNICEICRK 273

  Fly   206 TSSNRTKHCSVCNKCVGKFDHHCKWLNHCIGSRNYVAFLMCVVSAVVATLVIVAAVVAQIV--FY 268
            .:..|..||.||..||.:.|||..|||.|||.||||.:::.:..:.:|.|:.....:..|.  |.
  Fly   274 VTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLALSEIALLLGANLTLTSICHPFM 338

  Fly   269 YIQPDWLSF-YWCPTESSHTIESGD 292
            .::|  |.: ...|.:.|...|..|
  Fly   339 VVRP--LGYPVLLPDDCSEVFEGFD 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 28/87 (32%)
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 33/102 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.