DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17075 and Zdhhc23

DIOPT Version :9

Sequence 1:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_001007461.1 Gene:Zdhhc23 / 332175 MGIID:2685625 Length:425 Species:Mus musculus


Alignment Length:257 Identity:55/257 - (21%)
Similarity:91/257 - (35%) Gaps:96/257 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 RKGRRLHGLQLPLHPLQIFGWLVLLLFGVASYWV----LIPAFHARIQGPLYGLIT-GLYLVHIA 157
            ||.:.|..|.|.|..|   |::         |:|    ::|  ..|:......|:| ||.|:.:|
Mouse   128 RKEQTLFFLSLGLFSL---GYM---------YYVFLREVVP--QGRVGPTQLALLTCGLLLILLA 178

  Fly   158 SHLTALLTDPADKELRRVHRNDRIVPEFDRSKHSHVIE----------------------NGRCH 200
                          |.|..:|...:.. |:|..:..||                      |.|..
Mouse   179 --------------LYRAKKNPGYLSN-DKSPSNSQIECPVKKGQEKTKGFPGTDASGSLNNRTL 228

  Fly   201 LCNIRTSSN-----------------------RTKHCSVCNKCVGKFDHHCKWLNHCIGSRNYVA 242
            ..::|.||.                       |..||.:|..||.:.||||.|:|.|:|..|:.|
Mouse   229 KDDVRGSSRVGLDSPAKVKEDWCAKCQLVRPARAWHCRICGICVRRMDHHCVWINSCVGESNHQA 293

  Fly   243 FLMCVVSAVVATLVIVAAVVAQIVFYYIQPD---WLSFYWCPTESSHTIESGDFINITLSLS 301
            |::     .::..::.:.....:....|..|   :.:.::||         |.:.|.:.:||
Mouse   294 FIL-----ALSIFLLTSVYGISLTLNTICRDRSLFTALFYCP---------GVYANYSSALS 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 23/108 (21%)
Zdhhc23NP_001007461.1 DHHC 248..374 CDD:396215 25/108 (23%)
Interaction with NOS1. /evidence=ECO:0000250 422..425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.